DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaNE1 and AT3G28480

DIOPT Version :9

Sequence 1:NP_733374.1 Gene:PH4alphaNE1 / 43625 FlyBaseID:FBgn0039780 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001189994.1 Gene:AT3G28480 / 822478 AraportID:AT3G28480 Length:324 Species:Arabidopsis thaliana


Alignment Length:253 Identity:72/253 - (28%)
Similarity:108/253 - (42%) Gaps:56/253 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 PLKLEEHSLDPYVATFHDILSPGKISQLREMAVPRMHRSTVNPLPGGQLKKSAFRVSKNAWLAYE 385
            |.::.:.|..|.|..:...||..:.....::|..::.:|.|.....|:..:|...||    :..:
plant    53 PTRVTQLSWTPRVFLYEGFLSDEECDHFIKLAKGKLEKSMVADNDSGESVESEDSVS----VVRQ 113

  Fly   386 SHPTMVGMLRDLKDATGLDT------------TFC-----EQLQVANYGVGGHYEPHWDFFRDPN 433
            |...:..|     |:..:|.            ||.     |.:|:.:|..|..||||:|:|.|..
plant   114 SSSFIANM-----DSLEIDDIVSNVEAKLAAWTFLPEENGESMQILHYENGQKYEPHFDYFHDQA 173

  Fly   434 HYPAEEGNRIATAIFYLSEVEQGGATAFPF------------------LDIAVKPQLGNVLFWYN 480
            :... .|:||||.:.|||.||:||.|.||.                  ...||||:.|:.|.::|
plant   174 NLEL-GGHRIATVLMYLSNVEKGGETVFPMWKGKATQLKDDSWTECAKQGYAVKPRKGDALLFFN 237

  Fly   481 LHRSLDKDYRTKHAGCPVLKGSKWIGNVWIHEVTQTFARP------CDVFRDHEVSLE 532
            ||.:...|..:.|..|||::|.||....|||  .::|.|.      |   .|..||.|
plant   238 LHPNATTDSNSLHGSCPVVEGEKWSATRWIH--VKSFERAFNKQSGC---MDENVSCE 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaNE1NP_733374.1 P4Ha_N 26..155 CDD:285528
P4Hc 341..511 CDD:214780 58/204 (28%)
AT3G28480NP_001189994.1 PLN00052 51..324 CDD:177683 72/253 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.