DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaNE1 and P4H13

DIOPT Version :9

Sequence 1:NP_733374.1 Gene:PH4alphaNE1 / 43625 FlyBaseID:FBgn0039780 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_850038.1 Gene:P4H13 / 816841 AraportID:AT2G23096 Length:274 Species:Arabidopsis thaliana


Alignment Length:226 Identity:60/226 - (26%)
Similarity:98/226 - (43%) Gaps:36/226 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 SRGNHPYRFLAPLKLEEHSLDPYVATFHDILSPGKISQLREMAVPRMHRSTVNPLPGGQLKKSAF 374
            |..|.|:..|        |.:|.|....:..:..:...:.:||.|::..||:      .|:|...
plant    62 SVSNIPFHGL--------SWNPRVFYLPNFATKQQCEAVIDMAKPKLKPSTL------ALRKGET 112

  Fly   375 RVSKNAWLAYESH--PTMVGMLRDLKDATGLDTTF----CEQLQVANYGVGGHYEPHWDFFRDPN 433
            ..:...:.:...|  ....|:|..:::...|.|.|    .|...:..|.:|..|:.|:|.|....
plant   113 AETTQNYRSLHQHTDEDESGVLAAIEEKIALATRFPKDYYESFNILRYQLGQKYDSHYDAFHSAE 177

  Fly   434 HYPAEEGNRIATAIFYLSEVEQGGATAFPF---------------LDIAVKPQLGNVLFWYNLHR 483
            :.|. ...|:.|.:.:||.||:||.|.|||               :.:.|||:.|:.:|:|||..
plant   178 YGPL-ISQRVVTFLLFLSSVEEGGETMFPFENGRNMNGRYDYEKCVGLKVKPRQGDAIFFYNLFP 241

  Fly   484 SLDKDYRTKHAGCPVLKGSKWIGNVWIHEVT 514
            :...|..:.|..|||:||.||:...||.:.|
plant   242 NGTIDQTSLHGSCPVIKGEKWVATKWIRDQT 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaNE1NP_733374.1 P4Ha_N 26..155 CDD:285528
P4Hc 341..511 CDD:214780 51/190 (27%)
P4H13NP_850038.1 TatC <4..>40 CDD:294353
P4Hc 85..269 CDD:214780 51/190 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H119653
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.920

Return to query results.
Submit another query.