DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaNE1 and P4H5

DIOPT Version :9

Sequence 1:NP_733374.1 Gene:PH4alphaNE1 / 43625 FlyBaseID:FBgn0039780 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_179363.1 Gene:P4H5 / 816281 AraportID:AT2G17720 Length:291 Species:Arabidopsis thaliana


Alignment Length:208 Identity:66/208 - (31%)
Similarity:97/208 - (46%) Gaps:22/208 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 LEEHSLDPYVATFHDILSPGKISQLREMAVPRMHRSTVNPLPGGQLKKSAFRVSKNAWLAYESHP 388
            :|..|.:|....:|:.|:..:...|..:|.|.|.:|||.....|..|.|..|.|...:|. ..|.
plant    80 VEVISWEPRAVVYHNFLTNEECEHLISLAKPSMVKSTVVDEKTGGSKDSRVRTSSGTFLR-RGHD 143

  Fly   389 TMVGML-RDLKDATGLDTTFCEQLQVANYGVGGHYEPHWDFFRDPNHYPAEEGNRIATAIFYLSE 452
            .:|.:: :.:.|.|.:.....|.|||.:|.||..||||:|:|.| .......|.||||.:.|||:
plant   144 EVVEVIEKRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLD-EFNTKNGGQRIATVLMYLSD 207

  Fly   453 VEQGGATAFPFL-------------------DIAVKPQLGNVLFWYNLHRSLDKDYRTKHAGCPV 498
            |:.||.|.||..                   .::|.|:..:.|.::|:......|..:.|.||||
plant   208 VDDGGETVFPAARGNISAVPWWNELSKCGKEGLSVLPKKRDALLFWNMRPDASLDPSSLHGGCPV 272

  Fly   499 LKGSKWIGNVWIH 511
            :||:||....|.|
plant   273 VKGNKWSSTKWFH 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaNE1NP_733374.1 P4Ha_N 26..155 CDD:285528
P4Hc 341..511 CDD:214780 60/189 (32%)
P4H5NP_179363.1 PLN00052 75..290 CDD:177683 66/208 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.