DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaNE1 and Y43F8B.19

DIOPT Version :9

Sequence 1:NP_733374.1 Gene:PH4alphaNE1 / 43625 FlyBaseID:FBgn0039780 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001123044.2 Gene:Y43F8B.19 / 6418801 WormBaseID:WBGene00077688 Length:243 Species:Caenorhabditis elegans


Alignment Length:210 Identity:61/210 - (29%)
Similarity:94/210 - (44%) Gaps:36/210 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 LKLEEHSLDPYVATFHDILSPGKISQLREMAVPRMH-----RSTVNPLPGGQLKKSAFRVSKNAW 381
            :|:|..:..|.:..:.|:.: ||  |:|:......|     :..||  ..|....|..|.:....
 Worm    22 VKVEVVAWRPGLVIYRDLFT-GK--QVRDHLELMEHLKFEEQLVVN--DDGNDIVSKIRRANGTQ 81

  Fly   382 LAYESHP-------TMVGMLRDLKDATGLDTTFCEQLQVANYGVGGHYEPHWDFFRDPNHYPAEE 439
            :.:|.||       |...:|.:|...|      .|.:...:|..||||..|.|:..    ||:|:
 Worm    82 VFHEDHPAARSIWDTAKNLLPNLNFKT------AEDILALSYNPGGHYAAHHDYLL----YPSEK 136

  Fly   440 ---------GNRIATAIFYLSEVEQGGATAFPFLDIAVKPQLGNVLFWYNLHRSLDKDYRTKHAG 495
                     |||..|.|......|.||||.||.|..||:.:.|:..||:|...:.:::..::|||
 Worm   137 EWDEWMRVNGNRFGTLIMAFGAAESGGATVFPRLGAAVRTKPGDAFFWFNAMGNSEQEDLSEHAG 201

  Fly   496 CPVLKGSKWIGNVWI 510
            ||:.||.|.|..:|:
 Worm   202 CPIYKGQKQISTIWL 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaNE1NP_733374.1 P4Ha_N 26..155 CDD:285528
P4Hc 341..511 CDD:214780 57/191 (30%)
Y43F8B.19NP_001123044.2 P4Hc 43..217 CDD:214780 56/188 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.