DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaNE1 and CG4174

DIOPT Version :9

Sequence 1:NP_733374.1 Gene:PH4alphaNE1 / 43625 FlyBaseID:FBgn0039780 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001034031.2 Gene:CG4174 / 40023 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster


Alignment Length:521 Identity:125/521 - (23%)
Similarity:223/521 - (42%) Gaps:112/521 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SLASDYFSSITGLEDL-LHTEQYLTRELRSKVNAIQTALQQLESELSSIEKEHTMAASDTENYLT 81
            :::|:...|:..|::. ::..|...:.|:..:..|:.|::|.|..|.|.:              |
  Fly    30 AISSESQLSLLKLKETHVNNLQSYKKVLKKHLQKIRRAIRQSEELLKSTK--------------T 80

  Fly    82 NPVNV---YRLMKRLHTDW----SLME---GRVQLMAEEMNFNATREYGLSYPSQEDVEGAALAL 136
            :|.|:   |::::.||.||    .|::   |..|:...:|...       ..|:..|.|.:..|:
  Fly    81 SPRNLIYGYKVLRHLHNDWPQYFRLLKKDLGLEQIAVSQMLLT-------QQPTSVDFEESMGAM 138

  Fly   137 VRLQSTYKLDVAQVAQGILNGVKYGSDMSW--QDCFELGQQLFEMEDYNNTKVWLRESMERLRRQ 199
            .|||:.|.||...:.:|.::. |..:..:|  .:|..||.....::|||.::.||..::      
  Fly   139 HRLQTVYNLDSYAMTEGFIDD-KDKNIRNWSADECLMLGLMYLFLKDYNQSENWLELAL------ 196

  Fly   200 TSHAPSHLAPTSGPDTVTL------NKMEATAKSLFQLGDFDTAFELSQRVLQFDPKRIRNWHLG 258
                 .|......|:.:.:      |.:|:..::...||.:..|.:.:..:|..:|.  ..:.| 
  Fly   197 -----YHYDDNVSPEVLKIKLWNYPNLLESLVEANKGLGHYFEAKKYANELLSINPN--HTYML- 253

  Fly   259 DKGTAPPEDIDDVYLPKHSDSYSLSQEFAKYEKVCRGEVHPIVRQELR------CRYSRGNHPYR 317
                        ..|||.....|...:..|.:||.:.:.....::..|      |||.... |:.
  Fly   254 ------------TQLPKLKHLQSNPAKLTKPKKVFQLQKEICSKRYRRKSGVLVCRYVDWT-PFL 305

  Fly   318 FLAPLKLEEHSLDPYVATFHDILSPGKISQLREMAVPRMHRSTVNPLPG------GQLKKSAFRV 376
            .|||||:||.|:.||::.|:..|....|..|:.::.|::.|  :..|.|      |.|..|...|
  Fly   306 KLAPLKMEELSMKPYISIFYGFLGQKDIEVLKNVSRPKLQR--IEHLSGNCSCKIGNLSTSLHDV 368

  Fly   377 SKNAWLAYESHPTMVGMLRDLKDATGLDTTFCEQLQVANYGVGGHYEPHWDFFRDPNHYPAEEGN 441
            .:..      :..::|:       ||......:.|:|.|||:.|:|.|     .:|..:     |
  Fly   369 VRKV------NELILGI-------TGFPLKGNQMLEVINYGIAGNYNP-----EEPKIH-----N 410

  Fly   442 RIATAIFYLSEVEQGGATAFPFLDIAVKPQLGNVLFWYNLHRSLDKDYRTKHAGCPVLKGSKWIG 506
            : |.|..:||...:||...||...:.|:|:.|::|.|.||.:||      .:..||:|||:.|:.
  Fly   411 K-ANAFIFLSNAGKGGEIVFPSRHLKVRPRKGSMLVWENLKKSL------IYHQCPILKGNMWVA 468

  Fly   507 N 507
            |
  Fly   469 N 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaNE1NP_733374.1 P4Ha_N 26..155 CDD:285528 33/139 (24%)
P4Hc 341..511 CDD:214780 47/173 (27%)
CG4174NP_001034031.2 P4Ha_N 33..157 CDD:285528 34/144 (24%)
TPR repeat 169..197 CDD:276809 8/38 (21%)
TPR repeat 202..245 CDD:276809 7/42 (17%)
2OG-FeII_Oxy <362..470 CDD:304390 39/138 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461875
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.