DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaNE1 and CG34041

DIOPT Version :9

Sequence 1:NP_733374.1 Gene:PH4alphaNE1 / 43625 FlyBaseID:FBgn0039780 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster


Alignment Length:371 Identity:80/371 - (21%)
Similarity:152/371 - (40%) Gaps:77/371 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VLLVGLIFL-LAQGSLASDYFSSITGLEDLLHTEQYLTRELRSKVNAIQTALQQLESELSSIEKE 68
            :|.||||.: |:..:..:.:..|.:.:.::|..::.:.:.|.:.:.|::|.|:.::..|..:...
  Fly   238 ILSVGLIIVYLSYSNSENRHSLSKSKVINILKIQENVVKYLENYIYALETKLKTIDEALIDLATY 302

  Fly    69 HTMAASDTENYLTNPVNVYRLMKRLHTDWSLMEGRVQLMAEE-------MNFNATREYGLSYPSQ 126
            |.....|.....::||..|.|:..:.:||:    ..||..:|       .:..:.::|   .|::
  Fly   303 HIQFERDKLAIASSPVASYSLIHHMQSDWT----HWQLFLQEDPGKDELASLMSIKKY---LPTK 360

  Fly   127 EDVEGAALALVRLQSTYKLDVAQVAQGILNG--VKYGSD-----------------MSWQDCFEL 172
            .|:......:.::.:.|.:....:|.|::.|  .||.|.                 ||.:||..|
  Fly   361 NDISEVCHGISKMLNAYLMTAQDIANGVILGTQTKYISSALKLEYLYMEIICNRHLMSLRDCVAL 425

  Fly   173 GQQLFEMEDYNNTKVWLRESMERLRRQTSHAPSHLAPTSGPDTVTLNKMEATAKSLFQLGDFDTA 237
            .....||:|||.:|.||..::..|.......|  :.|::   .:.|...|...|.    .::..|
  Fly   426 SDHSMEMKDYNKSKEWLNVAISMLESSAYWDP--IVPSA---DLYLKLAEVYVKQ----QNWTLA 481

  Fly   238 FELSQRVLQFDPKRIR--------NWH--LGDKGTAPPEDIDDVYLPKHSDSYSLSQEFAKYEKV 292
            .|..:..|:.:|:..:        ::|  ||     ||:.      ||      |:.|...|...
  Fly   482 LETVEFALKSNPRNAQLIRMQKRLSYHILLG-----PPKS------PK------LNIENNDYRLR 529

  Fly   293 CRGEVHPIVRQELRCRYSRGNHPYRFLAPLKLEEHSLDPYVATFHD 338
            ..|.::.....::|..||       .|||:|.|...:||.|..:|:
  Fly   530 KNGSLYCFYDTKIRTFYS-------LLAPIKAEVLFIDPLVILYHE 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaNE1NP_733374.1 P4Ha_N 26..155 CDD:285528 24/135 (18%)
P4Hc 341..511 CDD:214780
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 24/135 (18%)
TPR repeat 452..491 CDD:276809 8/47 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462001
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.