DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaNE1 and P4htm

DIOPT Version :9

Sequence 1:NP_733374.1 Gene:PH4alphaNE1 / 43625 FlyBaseID:FBgn0039780 Length:537 Species:Drosophila melanogaster
Sequence 2:XP_217285.7 Gene:P4htm / 301008 RGDID:1311848 Length:503 Species:Rattus norvegicus


Alignment Length:432 Identity:104/432 - (24%)
Similarity:150/432 - (34%) Gaps:161/432 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 LNGVKYGSD-----MSWQDCF----ELGQQLFEMEDYNNTK-----VWLRESMERLRRQTSHAPS 205
            |.|:|.|.:     ::.:|.|    .|...|||:..:.:.:     :.|.: |:.|:|      |
  Rat   115 LEGIKVGYERKVQVVAGRDHFIRTLSLKPLLFEIPGFLSDEECRLIIHLAQ-MKGLQR------S 172

  Fly   206 HLAPTSGPDTVTLNKMEATAKSLFQLGD--FDTAFELSQRVLQFDPKRIRNWHLGDKGTAPPEDI 268
            .:.||...:. .::.|..:...||||.|  .|...:|.:.:.|        ..||:.....||:|
  Rat   173 QILPTEEYEE-AMSAMRVSQLDLFQLLDQNHDGRLQLREVLAQ--------TRLGNGRWMTPENI 228

  Fly   269 DDVYL-----PKHSDSYSLSQEFAKYEKVCRGEVHPIVRQELRCRYSRGNHPYRFLAPLKLEEHS 328
            .::|.     |......|| |||:              ..:||                      
  Rat   229 QEMYSAIKADPDGDGVLSL-QEFS--------------NMDLR---------------------- 256

  Fly   329 LDPYVATFHDILSPGKISQLREMAVPRMHRSTVNPLPGGQLKKSAFRVSKNAWL--AYESHPTMV 391
                  .||..:              |.|::..:.|         .|.|.:.||  ...:|..|.
  Rat   257 ------DFHKYM--------------RSHKAESSEL---------VRNSHHTWLHQGEGAHHVMR 292

  Fly   392 GMLRDLKDATGLD---TTFCEQLQVANYGVGGHYEPHWDFFRDP-------NH--------YPAE 438
            .:.:.:...|.|.   ....|.|||..||.||||..|.|  ..|       :|        .|.|
  Rat   293 AIRQRVLRLTRLSPEIVELSEPLQVVRYGEGGHYHAHVD--SGPVYPETVCSHTKLVANESVPFE 355

  Fly   439 EGNRIATAIFYLSEVEQGGATAFPFLD---------------------------IAVKPQLGNVL 476
            ...|..|.:|||:.|..||.|.||..|                           :.||||.|..:
  Rat   356 TSCRYMTVLFYLNNVTGGGETVFPVADNRTYDEMSLIQDNVDLRDTRRHCDKGNLRVKPQQGTAV 420

  Fly   477 FWYNL-------HRSLDKDYRTKHAGCPVLKGSKWIGNVWIH 511
            ||||.       ...:| || :.|.||.|.:|:|||.|.||:
  Rat   421 FWYNYLPDGQGWVGEVD-DY-SLHGGCLVTRGTKWIANNWIN 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaNE1NP_733374.1 P4Ha_N 26..155 CDD:285528 104/432 (24%)
P4Hc 341..511 CDD:214780 61/223 (27%)
P4htmXP_217285.7 EF-hand_7 193..253 CDD:404394 20/82 (24%)
P4Hc 247..459 CDD:214780 68/281 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343184
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.