DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaMP and AT1G20270

DIOPT Version :9

Sequence 1:NP_524594.2 Gene:PH4alphaMP / 43624 FlyBaseID:FBgn0026190 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_564109.1 Gene:AT1G20270 / 838615 AraportID:AT1G20270 Length:287 Species:Arabidopsis thaliana


Alignment Length:208 Identity:64/208 - (30%)
Similarity:98/208 - (47%) Gaps:23/208 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 EELHLDPLVVQLHQVIGSKDSDSLQKTARPRIKRSTVYSLGGNGGSTAAAFRTSQGASFNYSRNA 384
            |.|..:|.....|..:..::.:.|...|:|.:.:|||.. ...|.|..:..|||.|......|:.
plant    77 EVLSWEPRAFVYHNFLSKEECEYLISLAKPHMVKSTVVD-SETGKSKDSRVRTSSGTFLRRGRDK 140

  Fly   385 ATKLLSRHVGDFSGLNMDYAEDLQVANYGIGGHYEPHWDSFPENHIYQEGDLHGNRMATGIYYLA 449
            ..|.:.:.:.|::.:..|:.|.|||.:|..|..||||:|.|.:....:.|   |.||||.:.||:
plant   141 IIKTIEKRIADYTFIPADHGEGLQVLHYEAGQKYEPHYDYFVDEFNTKNG---GQRMATMLMYLS 202

  Fly   450 DVEAGGGTAFP-------FLP------------LLVTPERGSLLFWYNLHPSGDQDFRTKHAACP 495
            |||.||.|.||       .:|            |.|.|..|..|.::::.|....|..:.|..||
plant   203 DVEEGGETVFPAANMNFSSVPWYNELSECGKKGLSVKPRMGDALLFWSMRPDATLDPTSLHGGCP 267

  Fly   496 VLQGSKWIANVWI 508
            |::|:||.:..|:
plant   268 VIRGNKWSSTKWM 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaMPNP_524594.2 P4Ha_N 24..156 CDD:285528
P4Hc 336..509 CDD:214780 60/192 (31%)
AT1G20270NP_564109.1 CASIMO1 <3..38 CDD:420385
PLN00052 79..286 CDD:177683 63/206 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.