DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaMP and AT5G66060

DIOPT Version :9

Sequence 1:NP_524594.2 Gene:PH4alphaMP / 43624 FlyBaseID:FBgn0026190 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_201407.4 Gene:AT5G66060 / 836738 AraportID:AT5G66060 Length:289 Species:Arabidopsis thaliana


Alignment Length:237 Identity:71/237 - (29%)
Similarity:116/237 - (48%) Gaps:29/237 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 SKQRNLRCRLRKS--RLGYAPFK----LEELHLDPLVVQLHQVIGSKDSDSLQKTARPRIKRSTV 356
            ||..:|...:||:  |.|....|    :|.:..:|.....|..:..::...|.:.|:|.:::|||
plant    51 SKANDLTSIVRKTLQRSGEDDSKNERWVEIISWEPRASVYHNFLTKEECKYLIELAKPHMEKSTV 115

  Fly   357 YSLGGNGGSTAAAFRTSQGASFNYSRNAATKLLSRHVGDFSGLNMDYAEDLQVANYGIGGHYEPH 421
            .. ...|.||.:..|||.|......|:...:.:.:.:.||:.:.:::.|.|||.:|.||..||||
plant   116 VD-EKTGKSTDSRVRTSSGTFLARGRDKTIREIEKRISDFTFIPVEHGEGLQVLHYEIGQKYEPH 179

  Fly   422 WDSFPENHIYQEGDLHGNRMATGIYYLADVEAGGGTAFP-------FLP------------LLVT 467
            :|.|.:.:..:.|   |.|:||.:.||:|||.||.|.||       .:|            |.|.
plant   180 YDYFMDEYNTRNG---GQRIATVLMYLSDVEEGGETVFPAAKGNYSAVPWWNELSECGKGGLSVK 241

  Fly   468 PERGSLLFWYNLHPSGDQDFRTKHAACPVLQGSKWIANVWIR 509
            |:.|..|.::::.|....|..:.|..|.|::|:||.:..|:|
plant   242 PKMGDALLFWSMTPDATLDPSSLHGGCAVIKGNKWSSTKWLR 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaMPNP_524594.2 P4Ha_N 24..156 CDD:285528
P4Hc 336..509 CDD:214780 59/191 (31%)
AT5G66060NP_201407.4 PLN00052 74..288 CDD:177683 63/214 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.