DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaMP and AT4G35810

DIOPT Version :9

Sequence 1:NP_524594.2 Gene:PH4alphaMP / 43624 FlyBaseID:FBgn0026190 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001320148.1 Gene:AT4G35810 / 829735 AraportID:AT4G35810 Length:290 Species:Arabidopsis thaliana


Alignment Length:216 Identity:65/216 - (30%)
Similarity:104/216 - (48%) Gaps:27/216 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 LEELHLDPLVVQLHQVIGSKDSDSLQKTARPRIKRSTVYSLGGNGGSTAAAFRTSQGASFNYSRN 383
            ||.:..:|.....|..:.:::.:.|...|:|.:.:|.|..: ..|.|..:..|||.|...|...:
plant    80 LEVISWEPRAFVYHNFLTNEECEHLISLAKPSMMKSKVVDV-KTGKSIDSRVRTSSGTFLNRGHD 143

  Fly   384 AATKLLSRHVGDFSGLNMDYAEDLQVANYGIGGHYEPHWDSFPENHIYQEGDLHGNRMATGIYYL 448
            ...:.:...:.||:.:..:..|.|||.:|.:|..||||.|.|.:....::|   |.|:||.:.||
plant   144 EIVEEIENRISDFTFIPPENGEGLQVLHYEVGQRYEPHHDYFFDEFNVRKG---GQRIATVLMYL 205

  Fly   449 ADVEAGGGTAFPF-------LP------------LLVTP-ERGSLLFWYNLHPSGDQDFRTKHAA 493
            :||:.||.|.||.       :|            |.|.| :|.:|||| ::.|....|..:.|..
plant   206 SDVDEGGETVFPAAKGNVSDVPWWDELSQCGKEGLSVLPKKRDALLFW-SMKPDASLDPSSLHGG 269

  Fly   494 CPVLQGSKWIANVW--IRERN 512
            |||::|:||.:..|  :.|.|
plant   270 CPVIKGNKWSSTKWFHVHEYN 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaMPNP_524594.2 P4Ha_N 24..156 CDD:285528
P4Hc 336..509 CDD:214780 59/194 (30%)
AT4G35810NP_001320148.1 PLN00052 75..289 CDD:177683 63/213 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.