DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaMP and AT3G28490

DIOPT Version :9

Sequence 1:NP_524594.2 Gene:PH4alphaMP / 43624 FlyBaseID:FBgn0026190 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_189490.2 Gene:AT3G28490 / 822479 AraportID:AT3G28490 Length:288 Species:Arabidopsis thaliana


Alignment Length:215 Identity:61/215 - (28%)
Similarity:102/215 - (47%) Gaps:21/215 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 PFKLEELHLDPLVVQLHQVIGSKDSDSLQKTARPRIKRSTVYSLGGNGGSTAAAFRTSQGASFNY 380
            |.::.:|...|........:..::.|.|.|.|:.::::|.|.:...:|.|..:..|||.|.....
plant    29 PTRITQLSWTPRAFLYKGFLSDEECDHLIKLAKGKLEKSMVVADVDSGESEDSEVRTSSGMFLTK 93

  Fly   381 SRNAATKLLSRHVGDFSGLNMDYAEDLQVANYGIGGHYEPHWDSFPENHIYQEGDLHGNRMATGI 445
            .::.....:...:..::.|..:..|.||:.:|..|..|:||:|.|.:....:.|   |:|:||.:
plant    94 RQDDIVANVEAKLAAWTFLPEENGEALQILHYENGQKYDPHFDYFYDKKALELG---GHRIATVL 155

  Fly   446 YYLADVEAGGGTAFP----FLPLL--------------VTPERGSLLFWYNLHPSGDQDFRTKHA 492
            .||::|..||.|.||    ..|.|              |.|.:|..|.::|||.:|..|..:.|.
plant   156 MYLSNVTKGGETVFPNWKGKTPQLKDDSWSKCAKQGYAVKPRKGDALLFFNLHLNGTTDPNSLHG 220

  Fly   493 ACPVLQGSKWIANVWIRERN 512
            :|||::|.||.|..||..|:
plant   221 SCPVIEGEKWSATRWIHVRS 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaMPNP_524594.2 P4Ha_N 24..156 CDD:285528
P4Hc 336..509 CDD:214780 56/190 (29%)
AT3G28490NP_189490.2 PLN00052 28..288 CDD:177683 61/215 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.920

Return to query results.
Submit another query.