DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaMP and AT3G28480

DIOPT Version :9

Sequence 1:NP_524594.2 Gene:PH4alphaMP / 43624 FlyBaseID:FBgn0026190 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001189994.1 Gene:AT3G28480 / 822478 AraportID:AT3G28480 Length:324 Species:Arabidopsis thaliana


Alignment Length:280 Identity:73/280 - (26%)
Similarity:119/280 - (42%) Gaps:55/280 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 ESREFRMYEQVCRGELAPLPSKQRN--------------LRCRLRKSRLGYAPFKLEELHLDPLV 328
            :||.|..: .:|.....||.|...|              ::.:...|..|:.|.::.:|...|.|
plant     2 DSRIFLAF-SLCFLFTLPLISSAPNRFLTRSSNTRDGSVIKMKTSASSFGFDPTRVTQLSWTPRV 65

  Fly   329 VQLHQVIGSKDSDSLQKTARPRIKRSTVYSLGGNGGSTAAAFRTS---QGASF----------NY 380
            ......:..::.|...|.|:.::::|.|.. ..:|.|..:....|   |.:||          :.
plant    66 FLYEGFLSDEECDHFIKLAKGKLEKSMVAD-NDSGESVESEDSVSVVRQSSSFIANMDSLEIDDI 129

  Fly   381 SRNAATKLLSRHVGDFSGLNMDYAEDLQVANYGIGGHYEPHWDSFPENHIYQEGDLHGNRMATGI 445
            ..|...||.:     ::.|..:..|.:|:.:|..|..||||:|.|   |.....:|.|:|:||.:
plant   130 VSNVEAKLAA-----WTFLPEENGESMQILHYENGQKYEPHFDYF---HDQANLELGGHRIATVL 186

  Fly   446 YYLADVEAGGGTAFPFLP------------------LLVTPERGSLLFWYNLHPSGDQDFRTKHA 492
            .||::||.||.|.||...                  ..|.|.:|..|.::||||:...|..:.|.
plant   187 MYLSNVEKGGETVFPMWKGKATQLKDDSWTECAKQGYAVKPRKGDALLFFNLHPNATTDSNSLHG 251

  Fly   493 ACPVLQGSKWIANVWIRERN 512
            :|||::|.||.|..||..::
plant   252 SCPVVEGEKWSATRWIHVKS 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaMPNP_524594.2 P4Ha_N 24..156 CDD:285528
P4Hc 336..509 CDD:214780 58/203 (29%)
AT3G28480NP_001189994.1 PLN00052 51..324 CDD:177683 63/230 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.