DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaMP and AT-P4H-1

DIOPT Version :9

Sequence 1:NP_524594.2 Gene:PH4alphaMP / 43624 FlyBaseID:FBgn0026190 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_181836.1 Gene:AT-P4H-1 / 818910 AraportID:AT2G43080 Length:283 Species:Arabidopsis thaliana


Alignment Length:216 Identity:60/216 - (27%)
Similarity:98/216 - (45%) Gaps:21/216 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 RLGYAPFKLEELHLDPLVVQLHQVIGSKDSDSLQKTARPRIKRSTVYSLGGNGGSTAAAFRTSQG 375
            |:|..  |.|.:...|.::.||..:..::.:.|:..||||::.|||..: ..|....:..|||.|
plant    71 RIGNV--KPEVVSWSPRIIVLHDFLSPEECEYLKAIARPRLQVSTVVDV-KTGKGVKSDVRTSSG 132

  Fly   376 ASFNYSRNA--ATKLLSRHVGDFSGLNMDYAEDLQVANYGIGGHYEPHWDSFPENHIYQEGDLHG 438
            ....:...:  ..:.:.:.:..||.:..:..|.:||..|.....|:||.|.|.:....:.|   |
plant   133 MFLTHVERSYPIIQAIEKRIAVFSQVPAENGELIQVLRYEPQQFYKPHHDYFADTFNLKRG---G 194

  Fly   439 NRMATGIYYLADVEAGGGTAFPFL-------------PLLVTPERGSLLFWYNLHPSGDQDFRTK 490
            .|:||.:.||.|...||.|.||..             .:.|.|.:|..:.::::...|..|.|:.
plant   195 QRVATMLMYLTDDVEGGETYFPLAGDGDCTCGGKIMKGISVKPTKGDAVLFWSMGLDGQSDPRSI 259

  Fly   491 HAACPVLQGSKWIANVWIRER 511
            |..|.||.|.||.|..|:|::
plant   260 HGGCEVLSGEKWSATKWMRQK 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaMPNP_524594.2 P4Ha_N 24..156 CDD:285528
P4Hc 336..509 CDD:214780 52/187 (28%)
AT-P4H-1NP_181836.1 PLN00052 80..281 CDD:177683 56/205 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.