DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaMP and P4H5

DIOPT Version :9

Sequence 1:NP_524594.2 Gene:PH4alphaMP / 43624 FlyBaseID:FBgn0026190 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_179363.1 Gene:P4H5 / 816281 AraportID:AT2G17720 Length:291 Species:Arabidopsis thaliana


Alignment Length:244 Identity:74/244 - (30%)
Similarity:116/244 - (47%) Gaps:37/244 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 LPSKQRN------LRCRLRKSRL------GYAPFKLEELHLDPLVVQLHQVIGSKDSDSLQKTAR 348
            ||:..||      |...:|||..      |.....:|.:..:|..|..|..:.:::.:.|...|:
plant    45 LPNANRNSSKTNDLTNIVRKSETSSGDEEGNGERWVEVISWEPRAVVYHNFLTNEECEHLISLAK 109

  Fly   349 PRIKRSTVYSLGGNGGSTAAAFRTSQGASFNYSRNAATKLLSRHVGDFSGLNMDYAEDLQVANYG 413
            |.:.:|||.. ...|||..:..|||.|.......:...:::.:.:.||:.:.::..|.|||.:|.
plant   110 PSMVKSTVVD-EKTGGSKDSRVRTSSGTFLRRGHDEVVEVIEKRISDFTFIPVENGEGLQVLHYQ 173

  Fly   414 IGGHYEPHWDSFPENHIYQEGDLHGNRMATGIYYLADVEAGGGTAFP-------FLP-------- 463
            :|..||||:|.|.:....:.|   |.|:||.:.||:||:.||.|.||       .:|        
plant   174 VGQKYEPHYDYFLDEFNTKNG---GQRIATVLMYLSDVDDGGETVFPAARGNISAVPWWNELSKC 235

  Fly   464 ----LLVTP-ERGSLLFWYNLHPSGDQDFRTKHAACPVLQGSKWIANVW 507
                |.|.| :|.:|||| |:.|....|..:.|..|||::|:||.:..|
plant   236 GKEGLSVLPKKRDALLFW-NMRPDASLDPSSLHGGCPVVKGNKWSSTKW 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaMPNP_524594.2 P4Ha_N 24..156 CDD:285528
P4Hc 336..509 CDD:214780 61/192 (32%)
P4H5NP_179363.1 PLN00052 75..290 CDD:177683 65/214 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.