Sequence 1: | NP_524594.2 | Gene: | PH4alphaMP / 43624 | FlyBaseID: | FBgn0026190 | Length: | 535 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001123044.2 | Gene: | Y43F8B.19 / 6418801 | WormBaseID: | WBGene00077688 | Length: | 243 | Species: | Caenorhabditis elegans |
Alignment Length: | 201 | Identity: | 58/201 - (28%) |
---|---|---|---|
Similarity: | 91/201 - (45%) | Gaps: | 7/201 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 318 KLEELHLDP-LVVQLHQVIGSKDSDSLQKTARPRIKRSTVYSLGGNGGSTAAAFRTSQGAS-FNY 380
Fly 381 SRNAATKLLSRHVGDFSGLNMDYAEDLQVANYGIGGHYEPHWD--SFPENHIYQEG-DLHGNRMA 442
Fly 443 TGIYYLADVEAGGGTAFPFLPLLVTPERGSLLFWYNLHPSGDQDFRTKHAACPVLQGSKWIANVW 507
Fly 508 IRERNQ 513 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
PH4alphaMP | NP_524594.2 | P4Ha_N | 24..156 | CDD:285528 | |
P4Hc | 336..509 | CDD:214780 | 50/176 (28%) | ||
Y43F8B.19 | NP_001123044.2 | P4Hc | 43..217 | CDD:214780 | 49/175 (28%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1591 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |