DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaMP and P4HTM

DIOPT Version :9

Sequence 1:NP_524594.2 Gene:PH4alphaMP / 43624 FlyBaseID:FBgn0026190 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_808807.2 Gene:P4HTM / 54681 HGNCID:28858 Length:563 Species:Homo sapiens


Alignment Length:443 Identity:96/443 - (21%)
Similarity:145/443 - (32%) Gaps:189/443 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 HESALSLVN------HVLSIEPDQRSHLLEARQQLEELITDGDKNGLLHLTARRPG--------- 274
            ||..:.||.      ..||::|     ||   .::...:||.:...::|| |:..|         
Human   121 HERKVQLVTDRDHFIRTLSLKP-----LL---FEIPGFLTDEECRLIIHL-AQMKGLQRSQILPT 176

  Fly   275 -DYHESRE---------FRMYEQVCRGELAPLPSKQRNLRCRLRKSRLG----YAPFKLEELH-- 323
             :|.|:..         ||:.:|...|.|        .||..|.::|||    ..|..::|::  
Human   177 EEYEEAMSTMQVSQLDLFRLLDQNRDGHL--------QLREVLAQTRLGNGWWMTPESIQEMYAA 233

  Fly   324 --LDPLVVQLHQVIGSKDSD---SLQKTARPRIKRSTVYSLGGNGGSTAAAFRTS------QGAS 377
              .||            |.|   |||:.:...::....| :..:...::...|.|      ||..
Human   234 IKADP------------DGDGVLSLQEFSNMDLRDFHKY-MRSHKAESSELVRNSHHTWLYQGEG 285

  Fly   378 FNYSRNAATKLLSRHVGDFSGLNMDYAEDLQVANYGIGGHYEPHWDSFPENHIYQEGDLHGNRMA 442
            .::...|..:.:.| :...|...::.:|.|||..||.||||..|.||.|   :|.|......::.
Human   286 AHHIMRAIRQRVLR-LTRLSPEIVELSEPLQVVRYGEGGHYHAHVDSGP---VYPETICSHTKLV 346

  Fly   443 ----------------------------------------------------------------- 442
                                                                             
Human   347 ANESVPFETSCRQVSPNWGLPSILRPGTPMTQAQPCTVGVPLGMGPGDHWVIPVSPWEHPQLGTC 411

  Fly   443 ----------TGIYYLADVEAGGGTAFPFLP---------------------------LLVTPER 470
                      |.::||.:|..||.|.||...                           |.|.|::
Human   412 SVPPLPYSYMTVLFYLNNVTGGGETVFPVADNRTYDEMSLIQDDVDLRDTRRHCDKGNLRVKPQQ 476

  Fly   471 GSLLFWYNLHPS-----GDQDFRTKHAACPVLQGSKWIANVWIRERNQDNVRP 518
            |:.:||||..|.     ||.|..:.|..|.|.:|:|||||.||      ||.|
Human   477 GTAVFWYNYLPDGQGWVGDVDDYSLHGGCLVTRGTKWIANNWI------NVDP 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaMPNP_524594.2 P4Ha_N 24..156 CDD:285528
P4Hc 336..509 CDD:214780 60/288 (21%)
P4HTMNP_808807.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..111
EF-hand_7 192..252 CDD:290234 20/79 (25%)
EFh 194..252 CDD:238008 20/77 (26%)
P4Hc 246..519 CDD:214780 56/277 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149320
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.