DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaMP and CG34041

DIOPT Version :9

Sequence 1:NP_524594.2 Gene:PH4alphaMP / 43624 FlyBaseID:FBgn0026190 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster


Alignment Length:368 Identity:76/368 - (20%)
Similarity:159/368 - (43%) Gaps:66/368 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLAKCVLF--LVLQVLSCHGEFFSSTSGLAKLFETEVVLLAELQ-NYVNEINQHAEALQSEIDA 62
            ::.:.|:|.  |::..||     :|::.....|.:::|:.:.::| |.|..:..:..||::::..
  Fly   232 VMKSACILSVGLIIVYLS-----YSNSENRHSLSKSKVINILKIQENVVKYLENYIYALETKLKT 291

  Fly    63 I-------RVEHLNAADGIDDYLNNPVNAFRLIKRLHSDWETFEGSVTADSSRSNYLDTMASLKE 120
            |       ...|:..........::||.::.||..:.|||..::..:..|..:.. |.::.|:|:
  Fly   292 IDEALIDLATYHIQFERDKLAIASSPVASYSLIHHMQSDWTHWQLFLQEDPGKDE-LASLMSIKK 355

  Fly   121 NLSFPSQDDFVGSAIALTRLQQTYQLDVAELASGILNG--VKYGTA-----------------MS 166
            .|  |:::|.......::::...|.:...::|:|::.|  .||.::                 ||
  Fly   356 YL--PTKNDISEVCHGISKMLNAYLMTAQDIANGVILGTQTKYISSALKLEYLYMEIICNRHLMS 418

  Fly   167 WQDCFVLGQHLYALRDYNHTVPWLQQSMQLLGEQSYGSESA-SLDFMEAVVEYHREMGAHESALS 230
            .:||..|..|...::|||.:..||..::.:|...:|..... |.|....:.|.:.:......||.
  Fly   419 LRDCVALSDHSMEMKDYNKSKEWLNVAISMLESSAYWDPIVPSADLYLKLAEVYVKQQNWTLALE 483

  Fly   231 LVNHVLSIEPDQRSHLLEARQQLE-ELITDGDKNGLLHLTARRPGDYHESREFRMYEQVCRGELA 294
            .|...|...| :.:.|:..:::|. .::....|:..|::         |:.::|:          
  Fly   484 TVEFALKSNP-RNAQLIRMQKRLSYHILLGPPKSPKLNI---------ENNDYRL---------- 528

  Fly   295 PLPSKQRNLRC----RLRKSRLGYAPFKLEELHLDPLVVQLHQ 333
               .|..:|.|    ::|......||.|.|.|.:||||:..|:
  Fly   529 ---RKNGSLYCFYDTKIRTFYSLLAPIKAEVLFIDPLVILYHE 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaMPNP_524594.2 P4Ha_N 24..156 CDD:285528 26/139 (19%)
P4Hc 336..509 CDD:214780
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 25/131 (19%)
TPR repeat 452..491 CDD:276809 8/38 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461995
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.