DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaMP and P4htm

DIOPT Version :9

Sequence 1:NP_524594.2 Gene:PH4alphaMP / 43624 FlyBaseID:FBgn0026190 Length:535 Species:Drosophila melanogaster
Sequence 2:XP_217285.7 Gene:P4htm / 301008 RGDID:1311848 Length:503 Species:Rattus norvegicus


Alignment Length:349 Identity:89/349 - (25%)
Similarity:137/349 - (39%) Gaps:105/349 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 LVNHVLSIEPDQRSHLLEARQQLEELITDGDKNGLLHLTARRPGDYHESREFRMYEQVCRGELAP 295
            |:.|:..::..|||.:|.. ::.||.           ::|.|   ..:...|::.:|...|.|  
  Rat   159 LIIHLAQMKGLQRSQILPT-EEYEEA-----------MSAMR---VSQLDLFQLLDQNHDGRL-- 206

  Fly   296 LPSKQRNLRCRLRKSRLG----YAPFKLEELH----LDPLVVQLHQVIGSKDSD---SLQKTARP 349
                  .||..|.::|||    ..|..::|::    .||            |.|   |||:.:..
  Rat   207 ------QLREVLAQTRLGNGRWMTPENIQEMYSAIKADP------------DGDGVLSLQEFSNM 253

  Fly   350 RIKRSTVYSLGGNGGSTAAAFRTS------QGASFNYSRNAATKLLSRHVGDFSGLNMDYAEDLQ 408
            .::....| :..:...::...|.|      ||...::...|..:.:.| :...|...::.:|.||
  Rat   254 DLRDFHKY-MRSHKAESSELVRNSHHTWLHQGEGAHHVMRAIRQRVLR-LTRLSPEIVELSEPLQ 316

  Fly   409 VANYGIGGHYEPHWDS---FPENHIYQEGDLHGN---------RMATGIYYLADVEAGGGTAFPF 461
            |..||.||||..|.||   :||. :.....|..|         |..|.::||.:|..||.|.||.
  Rat   317 VVRYGEGGHYHAHVDSGPVYPET-VCSHTKLVANESVPFETSCRYMTVLFYLNNVTGGGETVFPV 380

  Fly   462 LP---------------------------LLVTPERGSLLFWYNLHPS-----GDQDFRTKHAAC 494
            ..                           |.|.|::|:.:||||..|.     |:.|..:.|..|
  Rat   381 ADNRTYDEMSLIQDNVDLRDTRRHCDKGNLRVKPQQGTAVFWYNYLPDGQGWVGEVDDYSLHGGC 445

  Fly   495 PVLQGSKWIANVWIRERNQDNVRP 518
            .|.:|:|||||.||      ||.|
  Rat   446 LVTRGTKWIANNWI------NVDP 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaMPNP_524594.2 P4Ha_N 24..156 CDD:285528
P4Hc 336..509 CDD:214780 61/225 (27%)
P4htmXP_217285.7 EF-hand_7 193..253 CDD:404394 19/79 (24%)
P4Hc 247..459 CDD:214780 57/214 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343195
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.