DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaMP and phy-4

DIOPT Version :9

Sequence 1:NP_524594.2 Gene:PH4alphaMP / 43624 FlyBaseID:FBgn0026190 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001123049.1 Gene:phy-4 / 189869 WormBaseID:WBGene00012815 Length:282 Species:Caenorhabditis elegans


Alignment Length:261 Identity:73/261 - (27%)
Similarity:126/261 - (48%) Gaps:20/261 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 ESREF--RMYEQVCRGELAPLPSKQRNLRC-RLRKSRLGYAPFKLEELHLDPLVVQLHQVIGSKD 339
            |:.||  ::::: |..||....|:...|.| ||.|..|   ..|:|.|..:|.::|.|..:..: 
 Worm    24 ETLEFNDKIWDK-CGKELRGDSSRDGRLVCYRLHKHLL---IRKVEILSSEPFILQYHNQVHRR- 83

  Fly   340 SDSLQKTARPRIKRSTVYSLGGNGGSTA---AAFRTSQGA-SFNYSRNAATKLLSRHVGDFSGLN 400
               |.|.|....:...:..|..:|.:|.   :..|.:.|. ..:..|.:..::......:.:.|:
 Worm    84 ---LAKRAVQEAEALRLEQLKISGFTTTPEKSQVRAANGTWLIHTGRPSFARIFEGLQANINSLD 145

  Fly   401 MDYAEDLQVANYGIGGHYEPHWDSF-PENHI-YQEGDLHGNRMATGIYYLADVEAGGGTAFPFLP 463
            :..||..|:.:|...|:|.||:|.. |..:: ..||  .|||:||.:..|...:.||.|.||.|.
 Worm   146 LSTAEPWQILSYNADGYYAPHYDYLNPATNVQLVEG--RGNRIATVLVILQIAKKGGTTVFPRLN 208

  Fly   464 LLVTPERGSLLFWYNLHPSGDQDFRTKHAACPVLQGSKWIANVWIRER-NQDNVRPCDLERGQEI 527
            |.:.|:.|.::.|.|...:|:.:.:|.|||||:.:|:|..|.:|:.|: ...|.:...|.|...:
 Worm   209 LNIRPKAGDVIVWLNTLSTGESNSQTLHAACPIHEGTKIGATLWVHEKIFSQNTKSTGLSRQNSL 273

  Fly   528 S 528
            :
 Worm   274 A 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaMPNP_524594.2 P4Ha_N 24..156 CDD:285528
P4Hc 336..509 CDD:214780 50/178 (28%)
phy-4NP_001123049.1 P4Hc 81..254 CDD:214780 50/178 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.