DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaMP and C14E2.4

DIOPT Version :9

Sequence 1:NP_524594.2 Gene:PH4alphaMP / 43624 FlyBaseID:FBgn0026190 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001359861.1 Gene:C14E2.4 / 182616 WormBaseID:WBGene00015773 Length:311 Species:Caenorhabditis elegans


Alignment Length:209 Identity:61/209 - (29%)
Similarity:92/209 - (44%) Gaps:23/209 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 KLEELHLDPLVVQLHQVIGSKD-SDSLQKTARPRIKRSTVYSLGGNGGSTAAAFRTSQG------ 375
            ::|.|...|.:|....|...|. ||.|:.....::....|  :..:|....:.:|.:.|      
 Worm    82 RMEILSWSPPLVIYRDVFSKKQVSDYLELLKNLKMNEQKV--VRDDGEIAYSTYRQANGTITPAH 144

  Fly   376 --ASFNYSRNAATKLLSRHVGDFSGLNMDYAEDLQVANYGIGGHYEPHWD----SFPENHIYQEG 434
              |......:.||:||.  |.||     .|.|.:...:|..||||..|.|    :..|:.....|
 Worm   145 SHAEAQSLMDTATQLLP--VFDF-----QYTEQISALSYIKGGHYALHTDFLTFANAEDSNRHFG 202

  Fly   435 DLHGNRMATGIYYLADVEAGGGTAFPFLPLLVTPERGSLLFWYNLHPSGDQDFRTKHAACPVLQG 499
            :: |||:||.|......|.||||.||.|..:.....|....|:|.:.:.:::.::.|..||:..|
 Worm   203 EM-GNRLATFIMVFKKAEKGGGTLFPQLGNVFRANPGDAFLWFNCNGNLEREAKSLHGGCPIRAG 266

  Fly   500 SKWIANVWIRERNQ 513
            .|.||.:|||..||
 Worm   267 EKIIATIWIRIFNQ 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaMPNP_524594.2 P4Ha_N 24..156 CDD:285528
P4Hc 336..509 CDD:214780 52/185 (28%)
C14E2.4NP_001359861.1 P4Hc 100..276 CDD:214780 52/185 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.