DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaSG2 and P4H2

DIOPT Version :9

Sequence 1:NP_651801.1 Gene:PH4alphaSG2 / 43623 FlyBaseID:FBgn0039779 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_566279.1 Gene:P4H2 / 819804 AraportID:AT3G06300 Length:299 Species:Arabidopsis thaliana


Alignment Length:214 Identity:68/214 - (31%)
Similarity:101/214 - (47%) Gaps:28/214 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 PLQVEPVHLDPDINVYHGMLSSKQILSIFEEADKEEMVRSAVA-GSGGEGTVRDLRVSQQTWLDY 378
            |.:|:.|...|...||.|.|:..:...:...| ||.:.||||| ...||..|.|:|.|..|::..
plant    35 PSKVKQVSSKPRAFVYEGFLTDLECDHLISLA-KENLQRSAVADNDNGESQVSDVRTSSGTFISK 98

  Fly   379 -KSPVMNSVGRIIQFVSGFDMAGAEHMQVANYGVGGQYEPHPDYF--EVNLPKNFEGDRISTSMF 440
             |.|:::.:...:...:.......|.:||..|..|.:|:.|.|||  :||:.:.  |.||:|.:.
plant    99 GKDPIVSGIEDKLSTWTFLPKENGEDLQVLRYEHGQKYDAHFDYFHDKVNIARG--GHRIATVLL 161

  Fly   441 YLSDVEQGGYTVF---------------------TKLNVFLPPVKGALVMWHNLHRSLHVDARTL 484
            |||:|.:||.|||                     .|..:.:.|.||..:::.||.:....|..:|
plant   162 YLSNVTKGGETVFPDAQEFSRRSLSENKDDLSDCAKKGIAVKPKKGNALLFFNLQQDAIPDPFSL 226

  Fly   485 HAGCPVIVGSKRIGNIWMH 503
            |.|||||.|.|.....|:|
plant   227 HGGCPVIEGEKWSATKWIH 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaSG2NP_651801.1 P4Ha_N 28..163 CDD:285528
P4Hc 335..503 CDD:214780 59/192 (31%)
P4H2NP_566279.1 P4Hc 55..245 CDD:214780 59/192 (31%)
ShKT 259..299 CDD:214586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.