DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaSG2 and AT-P4H-1

DIOPT Version :9

Sequence 1:NP_651801.1 Gene:PH4alphaSG2 / 43623 FlyBaseID:FBgn0039779 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_181836.1 Gene:AT-P4H-1 / 818910 AraportID:AT2G43080 Length:283 Species:Arabidopsis thaliana


Alignment Length:251 Identity:67/251 - (26%)
Similarity:101/251 - (40%) Gaps:28/251 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 FSNYTRLCQGRRLPEERS--GDPLRCYLDGKRHA------YFTLAPLQVEPVHLDPDINVYHGML 334
            |.|......|...|..|.  |...|...|..|.|      ...:..::.|.|...|.|.|.|..|
plant    29 FINRLEDSYGTGFPSLRGLRGQNTRYLRDVSRWANDKDAELLRIGNVKPEVVSWSPRIIVLHDFL 93

  Fly   335 SSKQILSIFEEADKEEMVRSAVAGSGGEGTVRDLRVSQQTWLDY---KSPVMNSVGRIIQFVSGF 396
            |.::...:...|.....|.:.|....|:|...|:|.|...:|.:   ..|::.::.:.|...|..
plant    94 SPEECEYLKAIARPRLQVSTVVDVKTGKGVKSDVRTSSGMFLTHVERSYPIIQAIEKRIAVFSQV 158

  Fly   397 DMAGAEHMQVANYGVGGQYEPHPDYF--EVNLPKNFEGDRISTSMFYLSDVEQGGYTVFT----- 454
            .....|.:||..|.....|:||.|||  ..||.:.  |.|::|.:.||:|..:||.|.|.     
plant   159 PAENGELIQVLRYEPQQFYKPHHDYFADTFNLKRG--GQRVATMLMYLTDDVEGGETYFPLAGDG 221

  Fly   455 ------KL--NVFLPPVKGALVMWHNLHRSLHVDARTLHAGCPVIVGSKRIGNIWM 502
                  |:  .:.:.|.||..|::.::......|.|::|.||.|:.|.|.....||
plant   222 DCTCGGKIMKGISVKPTKGDAVLFWSMGLDGQSDPRSIHGGCEVLSGEKWSATKWM 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaSG2NP_651801.1 P4Ha_N 28..163 CDD:285528
P4Hc 335..503 CDD:214780 50/186 (27%)
AT-P4H-1NP_181836.1 PLN00052 80..281 CDD:177683 56/200 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.