DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaSG2 and P4H13

DIOPT Version :9

Sequence 1:NP_651801.1 Gene:PH4alphaSG2 / 43623 FlyBaseID:FBgn0039779 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_850038.1 Gene:P4H13 / 816841 AraportID:AT2G23096 Length:274 Species:Arabidopsis thaliana


Alignment Length:201 Identity:48/201 - (23%)
Similarity:84/201 - (41%) Gaps:28/201 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 YHGM-----------LSSKQILSIFEEADKEEMVRSAVAGSGGE--GTVRDLRVSQQTWLDYKSP 381
            :||:           .::||......:..|.::..|.:|...||  .|.::.|...|...:.:|.
plant    68 FHGLSWNPRVFYLPNFATKQQCEAVIDMAKPKLKPSTLALRKGETAETTQNYRSLHQHTDEDESG 132

  Fly   382 VMNSVGRIIQFVSGFDMAGAEHMQVANYGVGGQYEPHPDYFEVNLPKNFEGDRISTSMFYLSDVE 446
            |:.::...|...:.|.....|...:..|.:|.:|:.|.|.|...........|:.|.:.:||.||
plant   133 VLAAIEEKIALATRFPKDYYESFNILRYQLGQKYDSHYDAFHSAEYGPLISQRVVTFLLFLSSVE 197

  Fly   447 QGGYTVFTKLN---------------VFLPPVKGALVMWHNLHRSLHVDARTLHAGCPVIVGSKR 496
            :||.|:|...|               :.:.|.:|..:.::||..:..:|..:||..||||.|.|.
plant   198 EGGETMFPFENGRNMNGRYDYEKCVGLKVKPRQGDAIFFYNLFPNGTIDQTSLHGSCPVIKGEKW 262

  Fly   497 IGNIWM 502
            :...|:
plant   263 VATKWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaSG2NP_651801.1 P4Ha_N 28..163 CDD:285528
P4Hc 335..503 CDD:214780 46/185 (25%)
P4H13NP_850038.1 TatC <4..>40 CDD:294353
P4Hc 85..269 CDD:214780 46/184 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.