DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaSG2 and P4H5

DIOPT Version :9

Sequence 1:NP_651801.1 Gene:PH4alphaSG2 / 43623 FlyBaseID:FBgn0039779 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_179363.1 Gene:P4H5 / 816281 AraportID:AT2G17720 Length:291 Species:Arabidopsis thaliana


Alignment Length:271 Identity:81/271 - (29%)
Similarity:120/271 - (44%) Gaps:50/271 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 VPGKNVQETKPSWFSNYTRLCQGRRLPEERSGDPLRCYLDGKRHAYFTLAPLQVEPVHLDPDINV 329
            :|..|...:|.:..:|..|..:.....||.:|:                  ..||.:..:|...|
plant    45 LPNANRNSSKTNDLTNIVRKSETSSGDEEGNGE------------------RWVEVISWEPRAVV 91

  Fly   330 YHGMLSSKQILSIFEEADKEEMVRSAVAG--SGGEGTVRDLRVSQQTWLDY-KSPVMNSVGRIIQ 391
            ||..|::::...:...| |..||:|.|..  :||....| :|.|..|:|.. ...|:..:.:.|.
plant    92 YHNFLTNEECEHLISLA-KPSMVKSTVVDEKTGGSKDSR-VRTSSGTFLRRGHDEVVEVIEKRIS 154

  Fly   392 FVSGFDMAGAEHMQVANYGVGGQYEPHPDYF--EVNLPKNFEGDRISTSMFYLSDVEQGGYTVF- 453
            ..:...:...|.:||.:|.||.:||||.|||  |.| .|| .|.||:|.:.|||||:.||.||| 
plant   155 DFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFN-TKN-GGQRIATVLMYLSDVDDGGETVFP 217

  Fly   454 -TKLNV------------------FLPPVKGALVMWHNLHRSLHVDARTLHAGCPVIVGSKRIGN 499
             .:.|:                  .||..:.||:.| |:.....:|..:||.||||:.|:|....
plant   218 AARGNISAVPWWNELSKCGKEGLSVLPKKRDALLFW-NMRPDASLDPSSLHGGCPVVKGNKWSST 281

  Fly   500 IWMHSGYQEFR 510
            .|.|  ..||:
plant   282 KWFH--VHEFK 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaSG2NP_651801.1 P4Ha_N 28..163 CDD:285528
P4Hc 335..503 CDD:214780 63/192 (33%)
P4H5NP_179363.1 PLN00052 75..290 CDD:177683 73/239 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.