DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaSG2 and p4htma

DIOPT Version :9

Sequence 1:NP_651801.1 Gene:PH4alphaSG2 / 43623 FlyBaseID:FBgn0039779 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001074160.1 Gene:p4htma / 791209 ZFINID:ZDB-GENE-070112-2222 Length:478 Species:Danio rerio


Alignment Length:310 Identity:70/310 - (22%)
Similarity:102/310 - (32%) Gaps:103/310 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 LDGKRHAYFTLAPLQVEPVHLDP-----DINVYHGMLSSKQILSIFEEAD--------------- 347
            |.|..|:.....|.|.|.:..|.     |:| ..|:|..::|||:....|               
Zfish   163 LKGLTHSSLLTNPDQEEQLTQDELFSLLDLN-QDGLLQREEILSLSHSTDGSWLSSYNLRKIHTG 226

  Fly   348 ----------KEEMVR---------SAVAGSGGEGTVRDLRVSQQTWLD------YKSPVMNSVG 387
                      .:|..|         .|..|..|...||......:.:|.      .|| |.|.|.
Zfish   227 LETNPSGVLSLQEFKRVSGGVLRYSGAAQGLDGHTKVRQRSTHTRLYLGEGTHHLLKS-VRNRVT 290

  Fly   388 RIIQFVSGF-DMAGAEHMQVANYGVG-------GQYEPHPD------YFEVNLPKNFEGDRISTS 438
            |:.:..|.. |:  :|.|:|..|..|       .....|||      :...| ..|....|..|.
Zfish   291 RLTRLPSSLVDL--SEAMEVVRYEQGVFSHAHHDSSPTHPDNSCTHTHLAAN-TSNQVACRYLTV 352

  Fly   439 MFYLSDVEQGGYTVF---------------------TKLNVFLPPVKGALVMWHNLHRS------ 476
            :.||:..:.||.|.|                     .|.|:.:.||.|..::|:| |.|      
Zfish   353 LLYLNSADSGGETSFPVADNRTYEEEVLGDLSQQYCDKGNLKVKPVAGTALLWYN-HLSDGNGWV 416

  Fly   477 LHVDARTLHAGCPVIVGSKRIGNIWMHSGYQEFRRPCNLTSDSYKSLAYR 526
            ..:|..:||..|.|..|.|..|::|:           |:..|..:...|:
Zfish   417 GELDEFSLHGDCLVTRGFKWTGSVWV-----------NIDPDQQRQERYQ 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaSG2NP_651801.1 P4Ha_N 28..163 CDD:285528
P4Hc 335..503 CDD:214780 56/248 (23%)
p4htmaNP_001074160.1 2OG-FeII_Oxy <272..442 CDD:304390 44/174 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583478
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.