DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaSG2 and P4htm

DIOPT Version :9

Sequence 1:NP_651801.1 Gene:PH4alphaSG2 / 43623 FlyBaseID:FBgn0039779 Length:527 Species:Drosophila melanogaster
Sequence 2:XP_217285.7 Gene:P4htm / 301008 RGDID:1311848 Length:503 Species:Rattus norvegicus


Alignment Length:277 Identity:73/277 - (26%)
Similarity:105/277 - (37%) Gaps:86/277 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 TRLCQGRRLPEERSGDPLRCYLDGKRHAYFTLAPLQVEPVHLDPDINVYHGMLSSKQILSIFEEA 346
            |||..||.:..|...:                   ....:..|||.:   |:||.:: .|..:..
  Rat   215 TRLGNGRWMTPENIQE-------------------MYSAIKADPDGD---GVLSLQE-FSNMDLR 256

  Fly   347 DKEEMVRSAVAGSGGEGTVRDLRVSQQTWL---DYKSPVMNSV-GRIIQF--VSGFDMAGAEHMQ 405
            |..:.:||..|.|.     ..:|.|..|||   :....||.:: .|:::.  :|...:..:|.:|
  Rat   257 DFHKYMRSHKAESS-----ELVRNSHHTWLHQGEGAHHVMRAIRQRVLRLTRLSPEIVELSEPLQ 316

  Fly   406 VANYGVGGQYEPH----PDYFE---------VNLPKNFEGD-RISTSMFYLSDVEQGGYTVF--- 453
            |..||.||.|..|    |.|.|         .|....||.. |..|.:|||::|..||.|||   
  Rat   317 VVRYGEGGHYHAHVDSGPVYPETVCSHTKLVANESVPFETSCRYMTVLFYLNNVTGGGETVFPVA 381

  Fly   454 ------------------------TKLNVFLPPVKGALVMWHNLHRSL--------HVDARTLHA 486
                                    .|.|:.:.|.:|..|.|:|.   |        .||..:||.
  Rat   382 DNRTYDEMSLIQDNVDLRDTRRHCDKGNLRVKPQQGTAVFWYNY---LPDGQGWVGEVDDYSLHG 443

  Fly   487 GCPVIVGSKRIGNIWMH 503
            ||.|..|:|.|.|.|::
  Rat   444 GCLVTRGTKWIANNWIN 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaSG2NP_651801.1 P4Ha_N 28..163 CDD:285528
P4Hc 335..503 CDD:214780 62/222 (28%)
P4htmXP_217285.7 EF-hand_7 193..253 CDD:404394 13/60 (22%)
P4Hc 247..459 CDD:214780 60/220 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343185
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.