DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaSG2 and phy-4

DIOPT Version :9

Sequence 1:NP_651801.1 Gene:PH4alphaSG2 / 43623 FlyBaseID:FBgn0039779 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001123049.1 Gene:phy-4 / 189869 WormBaseID:WBGene00012815 Length:282 Species:Caenorhabditis elegans


Alignment Length:227 Identity:63/227 - (27%)
Similarity:110/227 - (48%) Gaps:19/227 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 GRRLPEERSGD-PLRCYLDGKRHAYFTLAPLQVEPVHLDPDINVYHGMLSSKQILSIFEEADKEE 350
            |:.|..:.|.| .|.||   :.|.:..:.  :||.:..:|.|..||..:..:......:||:...
 Worm    37 GKELRGDSSRDGRLVCY---RLHKHLLIR--KVEILSSEPFILQYHNQVHRRLAKRAVQEAEALR 96

  Fly   351 MVRSAVAGSGGEGTVRDLRVSQQTWLDYKSPVMNSVGRIIQ----FVSGFDMAGAEHMQVANYGV 411
            :.:..::|.........:|.:..|||.:..  ..|..||.:    .::..|::.||..|:.:|..
 Worm    97 LEQLKISGFTTTPEKSQVRAANGTWLIHTG--RPSFARIFEGLQANINSLDLSTAEPWQILSYNA 159

  Fly   412 GGQYEPHPDYFEVNLPKNFE-----GDRISTSMFYLSDVEQGGYTVFTKLNVFLPPVKGALVMWH 471
            .|.|.||.||  :|...|.:     |:||:|.:..|...::||.|||.:||:.:.|..|.:::|.
 Worm   160 DGYYAPHYDY--LNPATNVQLVEGRGNRIATVLVILQIAKKGGTTVFPRLNLNIRPKAGDVIVWL 222

  Fly   472 NLHRSLHVDARTLHAGCPVIVGSKRIGNIWMH 503
            |...:...:::||||.||:..|:|....:|:|
 Worm   223 NTLSTGESNSQTLHAACPIHEGTKIGATLWVH 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaSG2NP_651801.1 P4Ha_N 28..163 CDD:285528
P4Hc 335..503 CDD:214780 48/176 (27%)
phy-4NP_001123049.1 P4Hc 81..254 CDD:214780 48/176 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.