DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaSG2 and C14E2.4

DIOPT Version :9

Sequence 1:NP_651801.1 Gene:PH4alphaSG2 / 43623 FlyBaseID:FBgn0039779 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001359861.1 Gene:C14E2.4 / 182616 WormBaseID:WBGene00015773 Length:311 Species:Caenorhabditis elegans


Alignment Length:214 Identity:55/214 - (25%)
Similarity:88/214 - (41%) Gaps:30/214 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 LQVEPVHLDPDINVYHGMLSSKQILSIFEEADKEEMVRSAVAGSGGE----------GTVRDL-- 368
            :::|.:...|.:.:|..:.|.||:....|.....:|....|....||          ||:...  
 Worm    81 VRMEILSWSPPLVIYRDVFSKKQVSDYLELLKNLKMNEQKVVRDDGEIAYSTYRQANGTITPAHS 145

  Fly   369 RVSQQTWLDYKSPVMNSVGRIIQFVSGFDMAGAEHMQVANYGVGGQYEPHPDYF------EVNLP 427
            ....|:.:|..:          |.:..||....|.:...:|..||.|..|.|:.      :.|..
 Worm   146 HAEAQSLMDTAT----------QLLPVFDFQYTEQISALSYIKGGHYALHTDFLTFANAEDSNRH 200

  Fly   428 KNFEGDRISTSMFYLSDVEQGGYTVFTKL-NVFLPPVKGALVMWHNLHRSLHVDARTLHAGCPVI 491
            ....|:|::|.:......|:||.|:|.:| |||... .|...:|.|.:.:|..:|::||.|||:.
 Worm   201 FGEMGNRLATFIMVFKKAEKGGGTLFPQLGNVFRAN-PGDAFLWFNCNGNLEREAKSLHGGCPIR 264

  Fly   492 VGSKRIGNIWMHSGYQEFR 510
            .|.|.|..||:....|..|
 Worm   265 AGEKIIATIWIRIFNQPIR 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaSG2NP_651801.1 P4Ha_N 28..163 CDD:285528
P4Hc 335..503 CDD:214780 50/186 (27%)
C14E2.4NP_001359861.1 P4Hc 100..276 CDD:214780 50/186 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.