DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaSG2 and LOC110438249

DIOPT Version :9

Sequence 1:NP_651801.1 Gene:PH4alphaSG2 / 43623 FlyBaseID:FBgn0039779 Length:527 Species:Drosophila melanogaster
Sequence 2:XP_021324927.1 Gene:LOC110438249 / 110438249 -ID:- Length:229 Species:Danio rerio


Alignment Length:241 Identity:93/241 - (38%)
Similarity:133/241 - (55%) Gaps:27/241 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 LCQGRRLPEERSGDPLRCYLDGKRHAYFTLAPLQVEPVHLD-PDINVYHGMLSSKQILSIFEEAD 347
            :|:.||    ..|:||..:               .|.|..| |.|..||..||..:|.:| :...
Zfish    10 VCRYRR----GRGNPLMLF---------------KEEVEWDQPMILRYHDFLSEGEIDTI-KTLA 54

  Fly   348 KEEMVRSAVAGS-GGEGTVRDLRVSQQTWL-DYKSPVMNSVGRIIQFVSGFDMAGAEHMQVANYG 410
            :.::.|:.|..: .|:......||||..|| :.:.||:..|.:.|..|:|.::..||.:|:||||
Zfish    55 RPKLSRAQVIDAVSGKRVSAASRVSQSAWLYEDEDPVVTQVNQRIADVTGLELQTAESLQIANYG 119

  Fly   411 VGGQYEPHPDYFEVNLPKNFE--GDRISTSMFYLSDVEQGGYTVFTKLNVFLPPVKGALVMWHNL 473
            :|||||||.|....| ..:|:  |.||:|.:.|:|||:.||.|||..:...|.|.:|:.|:|.||
Zfish   120 IGGQYEPHYDSKLTN-DSDFQLRGGRIATVLIYMSDVDIGGATVFPDVGAALQPKRGSAVLWFNL 183

  Fly   474 HRSLHVDARTLHAGCPVIVGSKRIGNIWMHSGYQEFRRPCN-LTSD 518
            .|:.:.|.|||||.|||.||||.:.|.|:.:..|||||.|: :.||
Zfish   184 LRNGNEDIRTLHAACPVFVGSKWVANKWIRTYGQEFRRKCSTIKSD 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaSG2NP_651801.1 P4Ha_N 28..163 CDD:285528
P4Hc 335..503 CDD:214780 71/171 (42%)
LOC110438249XP_021324927.1 PLN00052 28..218 CDD:177683 78/191 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D192165at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.