DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and PRSS22

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_071402.1 Gene:PRSS22 / 64063 HGNCID:14368 Length:317 Species:Homo sapiens


Alignment Length:276 Identity:79/276 - (28%)
Similarity:120/276 - (43%) Gaps:30/276 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLALAVAAATAIPTPEQKLVPTPVKDVKIQ--GRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGS 68
            |.:|.:.|:|||....:  :|.|....|.|  .|:..|..:.:.:.|:||.:  ..||...|.||
Human    18 FTSLLLLASTAILNAAR--IPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSI--QKNGTHHCAGS 78

  Fly    69 IIGNTWVLTAAHC----TNGASGVTINYGA-SLRNQPQYTHWVGSGNFVQHHHYN-SGNLHNDIS 127
            ::.:.||:|||||    .|.....::..|| .|.|....:..||......|..|: ......||:
Human    79 LLTSRWVITAAHCFKDNLNKPYLFSVLLGAWQLGNPGSRSQKVGVAWVEPHPVYSWKEGACADIA 143

  Fly   128 LIRTPH-VDFWHLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPL--PDWLQAVDVQIMSQS 189
            |:|... :.|...|..:.||..:.........|  .||||...||.||  |..||.:.|.|:...
Human   144 LVRLERSIQFSERVLPICLPDASIHLPPNTHCW--ISGWGSIQDGVPLPHPQTLQKLKVPIIDSE 206

  Fly   190 DCSRTW-------SLHDNMICIN-TNGGKSTCGGDSGGPLVTHEGNR--LVGVTSFVSSAGC-QS 243
            .||..:       .:.::|:|.. ..|.:..|.|||||||:......  |.|:.|:  ..|| :.
Human   207 VCSHLYWRGAGQGPITEDMLCAGYLEGERDACLGDSGGPLMCQVDGAWLLAGIISW--GEGCAER 269

  Fly   244 GAPAVFSRVTGYLDWI 259
            ..|.|:..::.:..|:
Human   270 NRPGVYISLSAHRSWV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 68/241 (28%)
Tryp_SPc 38..262 CDD:238113 68/242 (28%)
PRSS22NP_071402.1 Tryp_SPc 50..288 CDD:238113 68/242 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.