DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and CG34409

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:297 Identity:66/297 - (22%)
Similarity:125/297 - (42%) Gaps:63/297 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ALAVAAATAIPTPEQKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLF----SGNGNWWCGGS 68
            :|:...|:..|..::.   |....:.::.|:..|..|..|:.|::..:.:    |...::.|.||
  Fly   223 SLSTTTASMPPFAQEN---TQGCGINVESRLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGS 284

  Fly    69 IIGNTWVLTAAHC-TNGASGVTINYGASLRNQPQYTHWVGSGNFVQHHHYNSGNLHNDISLIR-- 130
            :|.:..::||||| .|..|.:.::: ..|.:|...|.: .....:.|.:|:.....|||:|:|  
  Fly   285 LISSNHIVTAAHCVVNLVSDLELSH-VRLGSQDGATPF-AIEQVIVHPNYDQPKYANDIALLRIN 347

  Fly   131 ------TPHVDFWHLVNKVELP-----SYNDRYQDYAGWWAVASGW--GGTYDGSPLPD-----W 177
                  ||          :.||     :..:|   ..|...||:||  |.|.:.|.:..     .
  Fly   348 STNGTFTP----------ICLPFNGPITLGNR---LIGQIGVAAGWSIGSTENNSSMDPSNSTAG 399

  Fly   178 LQAVDVQIMSQSDCSRTW-SLHDNM----------ICINTNGGKSTCGGDSGGPLV--------- 222
            ::.:.:.|::.:.|:..: ||.:|.          :|.........|.||||||.:         
  Fly   400 VRFIRLPIVNTTSCAIAYASLSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGPFMDDGTSGVFG 464

  Fly   223 THEGNRLVGVTSFVSSAGCQSGAPAVFSRVTGYLDWI 259
            |.....::|:.:|..:....:..|.|::.|:.:.|||
  Fly   465 TSGRYTIIGIVAFGPTLCGVTTIPGVYTLVSSFSDWI 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 60/266 (23%)
Tryp_SPc 38..262 CDD:238113 61/267 (23%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 60/266 (23%)
Tryp_SPc 252..501 CDD:238113 59/263 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435961
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.