DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and zgc:112285

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001020685.1 Gene:zgc:112285 / 561476 ZFINID:ZDB-GENE-050913-132 Length:316 Species:Danio rerio


Alignment Length:258 Identity:73/258 - (28%)
Similarity:103/258 - (39%) Gaps:45/258 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITNGYPAYEGKVPYIVGLLFSGNGN----WWCGGSIIGNTWVLTAAHC-----TNGASGVTINY 92
            ||.:|..|.....|:.|.|.....|:    ..|||::|...||||||||     ...||...|..
Zfish    58 RIVSGNEARPHSWPWQVSLQVRPRGSKHYVHVCGGTLIHKNWVLTAAHCFQKGKAEDASSWRIVL 122

  Fly    93 GA-SLRNQPQYTHWVGSGNFVQHHHYN---SGNLHNDISLIRTPHVDFWHLVNKVELPSYNDRYQ 153
            |. .|:.......:.......:|.|:.   ...|..||:|::.        ...:: ||...||.
Zfish   123 GKHQLKRSETAERFFPVKRIYRHEHFRYPAHSELDYDIALVKA--------ATDIQ-PSNFIRYA 178

  Fly   154 DY--------AGWWAVASGWGGTYDGS---PLPDWLQAVDVQIMSQSDC--SRTWS--LHDNMIC 203
            ..        .|.:...:|||.|..|.   .|.:.|....:.|:....|  .:.|.  :.|:|||
Zfish   179 CLPRKQINLNPGHYCWVTGWGDTRGGKENVSLAEALNQARLPIIDYKTCRQKKFWGDRVRDSMIC 243

  Fly   204 I---NTNGGKSTCGGDSGGPLVTHEGN---RLVGVTSFVSSAGCQ-SGAPAVFSRVTGYLDWI 259
            .   :|.|..:.|.|||||||:...|.   .:.|:.|| ...||. ...|:||:|...|:.||
Zfish   244 AGFRDTEGTPAACQGDSGGPLLCQVGRDRWEVHGIVSF-GPIGCTVENKPSVFTRTAAYIPWI 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 71/256 (28%)
Tryp_SPc 38..262 CDD:238113 72/257 (28%)
zgc:112285NP_001020685.1 Tryp_SPc 58..305 CDD:214473 71/256 (28%)
Tryp_SPc 59..308 CDD:238113 72/257 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.