DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and cela1.1

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001020645.2 Gene:cela1.1 / 553249 ZFINID:ZDB-GENE-050522-187 Length:282 Species:Danio rerio


Alignment Length:275 Identity:83/275 - (30%)
Similarity:134/275 - (48%) Gaps:31/275 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLVFLALAVAAATAIPTPEQKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNW--WC 65
            :|..|.|:|.||..:..|..      ::|:.|:.|:..|..|.....|:.:.|.:...|.:  :|
Zfish     1 MLRILLLSVLAAIGLTEPRY------LEDLAIEERVIGGEIAKPHSWPWQISLQYQSGGRYHHYC 59

  Fly    66 GGSIIGNTWVLTAAHCTNGASGVTINYGASLRNQPQYTH-----WVG-SGNFVQHHHYNSGNL-- 122
            ||::|...||:.||||.: .|.:   :..:|.:....||     ::. .|.|: |.::|...:  
Zfish    60 GGTLIRPGWVMVAAHCVD-TSRI---WSVALGDHDTTTHEGPEQYISVKGVFI-HPNWNPNIVAN 119

  Fly   123 HNDISLIR-TPHVDFWHLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIM 186
            .|||:|:: :.:......|....||||.: ...| |.....:|||.|..|..|...|:...:.::
Zfish   120 GNDIALLQLSINATLSSYVQVATLPSYGE-ILPY-GHTCYITGWGRTQTGGSLSAQLKQAYMPVV 182

  Fly   187 SQSDCSRT--W--SLHDNMICINTNGGKSTCGGDSGGPL-VTHEGNRLV-GVTSFVSSAGCQS-G 244
            ....||::  |  ::.|.|||.......|.|.||||.|| ....|..:| ||||||:|:||.: .
Zfish   183 DHETCSQSDWWGSTVKDRMICAGGTTSMSACHGDSGSPLNCLFNGEYVVHGVTSFVASSGCNTYK 247

  Fly   245 APAVFSRVTGYLDWI 259
            .|.||:||:.::.|:
Zfish   248 KPTVFTRVSYHVSWL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 73/239 (31%)
Tryp_SPc 38..262 CDD:238113 73/240 (30%)
cela1.1NP_001020645.2 Tryp_SPc 29..261 CDD:214473 73/238 (31%)
Tryp_SPc 30..265 CDD:238113 73/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.