DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and Tpsab1

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_062195.2 Gene:Tpsab1 / 54271 RGDID:3066 Length:310 Species:Rattus norvegicus


Alignment Length:285 Identity:88/285 - (30%)
Similarity:123/285 - (43%) Gaps:47/285 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLV----FLALAVAAATAIPTPEQKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNG 61
            :|||:    .|:..|.||.::..|.:.:|              .|..|...|.|:.|.|..  |.
  Rat    39 LKLLLLTLPLLSSLVHAAPSLAMPREGIV--------------GGQEASGNKWPWQVSLRV--ND 87

  Fly    62 NWW---CGGSIIGNTWVLTAAHCTNGASGVTINYGASLRNQPQY--THWVGSGNFVQHHHYNSGN 121
            .:|   ||||:|...||||||||..............||.|..|  .|.:.....:.|..:....
  Rat    88 TYWMHFCGGSLIHPQWVLTAAHCVGPNKADPNKLRVQLRKQYLYYHDHLLTVSQIISHPDFYIAQ 152

  Fly   122 LHNDISLIR-TPHVDFWHLVNKVELPSYNDRYQDYAGWWAVASGWGGTYD--GSPLPDWLQAVDV 183
            ...||:|:: |..|:....|:.|.||..::.:......|  .:|||...:  ..|.|..|:.|.|
  Rat   153 DGADIALLKLTNPVNITSNVHTVSLPPASETFPSGTLCW--VTGWGNINNDVSLPPPFPLEEVQV 215

  Fly   184 QIMSQSDCSRTW--------SLH---DNMICINTNGGKSTCGGDSGGPLVTH-EGNRL-VGVTSF 235
            .|:....|...:        ::|   |:|:|.. |.|..:|.||||||||.. |...| .||.|:
  Rat   216 PIVENRLCDLKYHKGLNTGDNVHIVRDDMLCAG-NEGHDSCQGDSGGPLVCKVEDTWLQAGVVSW 279

  Fly   236 VSSAGC-QSGAPAVFSRVTGYLDWI 259
              ..|| |...|.:::|||.|||||
  Rat   280 --GEGCAQPNRPGIYTRVTYYLDWI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 77/243 (32%)
Tryp_SPc 38..262 CDD:238113 79/244 (32%)
Tpsab1NP_062195.2 Tryp_SPc 66..302 CDD:214473 78/256 (30%)
Tryp_SPc 66..302 CDD:238113 78/256 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.