DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and ctrl

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001004582.1 Gene:ctrl / 447843 ZFINID:ZDB-GENE-040912-147 Length:261 Species:Danio rerio


Alignment Length:280 Identity:90/280 - (32%)
Similarity:128/280 - (45%) Gaps:50/280 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLVFLALAVAAAT---AIPTPEQKLVPTPVKDVKIQG--RITNGYPAYEGKVPYIVGLLFSGNGN 62
            |.:....|:.|:|   .:|.         :|.| |.|  ||.||..|..|..|:.|.|..| ||.
Zfish     2 LWIISCFALVASTLGCGVPA---------IKPV-ISGYNRIVNGENAVSGSWPWQVSLQQS-NGF 55

  Fly    63 WWCGGSIIGNTWVLTAAHCTNGASGVTINYGASLRNQPQYTHWVGS-GNFVQHHHYNSGNLHNDI 126
            .:||||:|...||:|||||...|....:..|...|.....:..|.| ...:.|.:|||.|.:|||
Zfish    56 HFCGGSLINQYWVVTAAHCRVQAGYHYVILGEHDRGSSAESVQVKSIAKAITHPYYNSQNFNNDI 120

  Fly   127 SLIR--TPHVDFWHLVNKV----------ELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQ 179
            :|::  :|.    .|.:::          .:||         |...|.:|||.|...|. |..||
Zfish   121 TLLKLSSPA----QLTSRISPVCLAASSTSIPS---------GTRCVTTGWGKTGSTSS-PRILQ 171

  Fly   180 AVDVQIMSQSDCSRTWS---LHDNMICINTNGGKSTCGGDSGGPLVTHEGNR--LVGVTSFVSSA 239
            ...:.::|.:.|.:.|.   :.|.|||...: |.|:|.||||||||......  .||:.|: .::
Zfish   172 QTALPLLSPAQCKQYWGQNRITDAMICAGAS-GVSSCQGDSGGPLVCESSGAWYQVGIVSW-GTS 234

  Fly   240 GCQSGAPAVFSRVTGYLDWI 259
            .|....|||::||:....||
Zfish   235 DCNVRTPAVYARVSYLRQWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 79/239 (33%)
Tryp_SPc 38..262 CDD:238113 80/240 (33%)
ctrlNP_001004582.1 Tryp_SPc 31..254 CDD:214473 79/239 (33%)
Tryp_SPc 32..257 CDD:238113 80/240 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.