DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and CTRB2

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001020371.3 Gene:CTRB2 / 440387 HGNCID:2522 Length:263 Species:Homo sapiens


Alignment Length:231 Identity:78/231 - (33%)
Similarity:120/231 - (51%) Gaps:13/231 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASLRNQPQ 101
            ||.||..|..|..|:.|.|. ...|..:||||:|...||:|||||....|.|.:.......:..:
Human    33 RIVNGEDAVPGSWPWQVSLQ-DKTGFHFCGGSLISEDWVVTAAHCGVRTSDVVVAGEFDQGSDEE 96

  Fly   102 YTHWVGSGNFVQHHHYNSGNLHNDISLIR--TPHVDFWHLVNKVELPSYNDRYQDYAGWWAVASG 164
            ....:......::..::...::|||:|::  || ..|...|:.|.|||.:|.:.  ||.....:|
Human    97 NIQVLKIAKVFKNPKFSILTVNNDITLLKLATP-ARFSQTVSAVCLPSADDDFP--AGTLCATTG 158

  Fly   165 WGGT-YDGSPLPDWLQAVDVQIMSQSDCSRTWS--LHDNMICINTNGGKSTCGGDSGGPLVTHEG 226
            ||.| |:.:..||.||...:.::|.::|.::|.  :.|.|||...: |.|:|.||||||||..:.
Human   159 WGKTKYNANKTPDKLQQAALPLLSNAECKKSWGRRITDVMICAGAS-GVSSCMGDSGGPLVCQKD 222

  Fly   227 N--RLVGVTSFVSSAGCQSGAPAVFSRVTGYLDWIR 260
            .  .|||:.|: .|..|.:..|||::||...:.|::
Human   223 GAWTLVGIVSW-GSRTCSTTTPAVYARVAKLIPWVQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 77/228 (34%)
Tryp_SPc 38..262 CDD:238113 77/230 (33%)
CTRB2NP_001020371.3 Tryp_SPc 33..256 CDD:214473 77/228 (34%)
Tryp_SPc 34..259 CDD:238113 77/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.