DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and CG11842

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:263 Identity:68/263 - (25%)
Similarity:109/263 - (41%) Gaps:62/263 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ITNGYPAYEGKVPYIVGLLF---SGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGA----- 94
            |..|.||...:.|:...|..   :|...|:|||::|.:..|||||||.....| ::|...     
  Fly    73 IIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQG-SVNIARLGDLE 136

  Fly    95 -SLRNQPQYTHWVGSGNFVQHHHYNSGNLHNDISLIRTPH-VDFWHLVNKVELPSYNDRYQDYAG 157
             ...|...........:|..|..::...::||||::|... |.|....:...||..:.|    .|
  Fly   137 FDTNNDDADPEDFDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACLPFDDGR----LG 197

  Fly   158 WWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSD---------------CSRTWSLHDNM------ 201
            ...:|.|||               .::|:.:::               |..|...:|.:      
  Fly   198 TSFIAIGWG---------------QLEIVPRTENKKLQKVKLYNYGTRCRITADRNDELPEGYNA 247

  Fly   202 ---ICINTNGGKSTCGGDSGGPLVTHEGN-----RLVGVTSFVSSAGCQS-GAPAVFSRVTGYLD 257
               :||.:|..|.||.||||||::.:..:     .::|:||.  ...|.: ..||:::||..|||
  Fly   248 TTQLCIGSNEHKDTCNGDSGGPVLIYHMDYPCMYHVMGITSI--GVACDTPDLPAMYTRVHFYLD 310

  Fly   258 WIR 260
            ||:
  Fly   311 WIK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 66/260 (25%)
Tryp_SPc 38..262 CDD:238113 68/263 (26%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 68/263 (26%)
Tryp_SPc 73..312 CDD:214473 66/260 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437128
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.