DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and CG11841

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:321 Identity:78/321 - (24%)
Similarity:129/321 - (40%) Gaps:83/321 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLVFLALAVAAATAIPTPEQKLVPTPVKDVKIQGR--------------------------ITNG 41
            ||||...:.......|.|..:|..|..|.:..:.|                          |.:|
  Fly    11 LLVFSLSSSLVQGQNPDPFAQLACTKFKQIVFEERVAISFFFTDAPITYETVDSCHGSRPLIVDG 75

  Fly    42 YPAYEGKVPYIVGLLFSGNGN---WWCGGSIIGNTWVLTAAHC---TNGASGVT----INYGASL 96
            .||...:.|:...|......|   |:|||::|.|..|||||||   .:|...|.    :.:....
  Fly    76 TPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELEFDTDT 140

  Fly    97 RN-QPQYTHWVGSGNFVQHHHYNSGNLHNDISLIRTP-HVDFWHLVNKVELPS---YNDRYQDYA 156
            .: :|:.   .|......|..:.:..|:|||.:::.. .|.|    |:.:.|:   ::|..|..:
  Fly   141 DDAEPED---FGVLALKAHPGFENPQLYNDIGIVQLDREVKF----NRYKHPACLPFDDGEQHES 198

  Fly   157 GWWAVASGWG----GTYDGSPLPDWLQAVDVQIMSQSD-CSRTWSLHDNM---------ICINTN 207
               .:|.|||    ...:...|      :.||:....| |..:...:|.:         :||.:.
  Fly   199 ---FIAIGWGQKKFAQKESKKL------LKVQLQGYKDRCVSSVDANDELPNGYEPKSQLCIGSR 254

  Fly   208 GGKSTCGGDSGGPLVTHEGN-----RLVGVTSFVSSAG--CQS-GAPAVFSRVTGYLDWIR 260
            ..|.||.||||||::.:..:     .::|:|    |||  |.: ..|:.::||..:|:||:
  Fly   255 DNKDTCNGDSGGPVLAYHKDLACMYHVMGIT----SAGITCSTPDIPSAYTRVHYFLNWIK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 67/284 (24%)
Tryp_SPc 38..262 CDD:238113 68/260 (26%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 67/258 (26%)
Tryp_SPc 72..310 CDD:214473 66/257 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437129
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.