DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and CG4815

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:233 Identity:63/233 - (27%)
Similarity:100/233 - (42%) Gaps:49/233 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 VGL-LFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASLRNQPQYTHWVG--SGNFVQH 114
            ||: ||:|. ...|..:::....:||||||....            |:.:: |.:|  |..|..|
  Fly    49 VGIQLFNGR-KLVCSATLLTPRHILTAAHCFENL------------NRSKF-HVIGGKSAEFTWH 99

  Fly   115 HHYNSGNLHNDISLIRTP-HVDFWHL-------VNKVELPSYNDRYQDYAGWW---------AVA 162
                 ||..|...|||.. |..:..:       |.|.:.| ...:|..||...         .:|
  Fly   100 -----GNNFNKNKLIRVQIHPKYAKMKFIADVAVAKTKYP-LRSKYIGYAQLCRSVLHPRDKLIA 158

  Fly   163 SGW---GGTYDGSPLPDWLQAVDVQIMSQSDCSRTW--SLHDNMICINTNGGKSTCGGDSGGPLV 222
            :||   ||.:|.|....: :::.|.|:|:.||.:..  .:..|:||......|:.|.|||||||:
  Fly   159 AGWGFEGGVWDESRKKTF-RSMKVGIVSKRDCEKQLDRKMPPNIICAGAYNNKTLCFGDSGGPLL 222

  Fly   223 THEGNRLVGVTSFVSSAGCQSGAPAVFSRVTGYLDWIR 260
            .  |.::.|:.::....| .:..|.|:..|..|..:|:
  Fly   223 L--GRQVCGINTWTFKCG-NNEKPDVYMGVRYYAKFIK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 62/230 (27%)
Tryp_SPc 38..262 CDD:238113 63/233 (27%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 63/233 (27%)
Trypsin 49..256 CDD:278516 62/230 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471121
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.