DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and CG16710

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:269 Identity:75/269 - (27%)
Similarity:115/269 - (42%) Gaps:57/269 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITNGYPAYEGKVPYIVGLLFSGNG-NWW-------CGGSIIGNTWVLTAAHC--TNGASGVTIN 91
            ||..|......::|::..:|::... :.|       |.||:|.|.:|||||||  ..|.....:.
  Fly   105 RIFGGEETQPNELPWMALILYAHRSRSVWNERLVSRCAGSLITNRYVLTAAHCLRITGLDLRRVR 169

  Fly    92 YGAS--LRNQPQYTHWVGSGN------------FVQHHHYN--SGNLHNDISLIRTPH-VDFWHL 139
            .|..  |.|....||..|..:            .::|.||.  ....:|||:|:|... |.:...
  Fly   170 LGEHNILSNPDCVTHINGREHCAPEHLEIDVDLSIKHRHYMVFEERPYNDIALLRLKFPVRYTAQ 234

  Fly   140 VNK--VEL------PSYNDRYQDYAGW-WAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDCSRTW 195
            :..  |:|      ||:::.....||| .:...|:....        |||. |...:..:||.:.
  Fly   235 IKPICVQLDYIFSNPSFSNHKLQIAGWGLSHKQGYSNVL--------LQAY-VNGRNADECSLSE 290

  Fly   196 -SL---HDNMICINTNGGKSTCGGDSGGPL--VTHEGNR----LVGVTSFVSSAGCQSGAPAVFS 250
             ||   .:..||....||..||.|||||||  :...|:.    |.|:||:..|. |..| ||.::
  Fly   291 PSLGLDKETHICAGNLGGNDTCKGDSGGPLMAIMERGDEEFVYLAGITSYGYSQ-CGYG-PAAYT 353

  Fly   251 RVTGYLDWI 259
            :.:.:::||
  Fly   354 KTSKFVEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 73/267 (27%)
Tryp_SPc 38..262 CDD:238113 74/268 (28%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 73/267 (27%)
Tryp_SPc 106..362 CDD:238113 72/266 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435957
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.