DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and CG31199

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:296 Identity:63/296 - (21%)
Similarity:100/296 - (33%) Gaps:88/296 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAVAAATAIPTPEQKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNT 73
            |.:.:..||||..|.:           .||..| ..:|||:        ..||   |.|.::...
  Fly    38 LNMQSTFAIPTEHQWV-----------ARIVYG-KGFEGKI--------RDNG---CLGVLVSKR 79

  Fly    74 WVLTAAHC---TNG-ASGVTINYGASLRNQPQYTHWVG------SGNFVQ------------HHH 116
            .||..|||   .|| |...:::.|...::.|     ||      .|..|:            |..
  Fly    80 TVLAPAHCFVQYNGVAEAFSVHLGVHNKSAP-----VGVRVCETDGYCVRPSQEIKLAEIAIHPD 139

  Fly   117 YNSGNLHNDISLIRTPH-VDFWHLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQA 180
            |:|..|.|.::::.... ...:..|..:.:|..:...:.......|.:|. ..::...|..|   
  Fly   140 YDSRTLKNSLAVLTLQRDAKIYPNVMPICMPPPSLLNETLVAQTFVVAGL-RVFEDFRLKTW--- 200

  Fly   181 VDVQIMSQSDCS---RTWSLHDNMICINTNGGKSTCGGDSGGPLV-------THEGNRLVGV--- 232
              |..:|:..|.   :|.....|.:|   ...|.......|.|||       ..:...|||:   
  Fly   201 --VNTLSRGFCQSKVKTLVTSSNTVC---GYHKQPVAYYLGAPLVGLQKKGHVTQNYYLVGIMID 260

  Fly   233 -----TSFVSSAGCQSGAPAVFSRVTGYLDWIRDNT 263
                 ...:||          |..:..|:|:||.|:
  Fly   261 WRWENNRIMSS----------FLAIRNYMDFIRQNS 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 54/262 (21%)
Tryp_SPc 38..262 CDD:238113 55/264 (21%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 53/248 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.