DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and CG5246

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:280 Identity:83/280 - (29%)
Similarity:124/280 - (44%) Gaps:40/280 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLVFLALAV----AAATAIPTPEQKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNG 61
            ||.||.:::.|    .:|.::....:..:...:..||.:.|:..|..:..|..||.|.:: :..|
  Fly     1 MKCLVLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIM-NTFG 64

  Fly    62 NWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASLRNQPQYT----HWVGSGNFVQHHHYNSGNL 122
            ...||||||...|:||||||...    .|.|...:.....||    .::..|:.: |..::....
  Fly    65 EHVCGGSIIAPQWILTAAHCMEW----PIQYLKIVTGTVDYTRPGAEYLVDGSKI-HCSHDKPAY 124

  Fly   123 HNDISLIRTPHVDFW-------HLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQA 180
            ||||:||.|.....:       .|.:|..||...|:        ...:|||.|.........||.
  Fly   125 HNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDK--------LTLTGWGSTKTWGRYSTQLQK 181

  Fly   181 VDVQIMSQSDC-----SRTWSLHDNMICINTNGGKSTCGGDSGGPLVTHEGNR-LVGVTSFVSSA 239
            :|:..:...:|     :..| |.:..:|..|..|:.:|.||||||||  :.|: ||||.::  ..
  Fly   182 IDLNYIDHDNCQSRVRNANW-LSEGHVCTFTQEGEGSCHGDSGGPLV--DANQTLVGVVNW--GE 241

  Fly   240 GCQSGAPAVFSRVTGYLDWI 259
            .|..|.|.||..|..|.|||
  Fly   242 ACAIGYPDVFGSVAYYHDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 73/238 (31%)
Tryp_SPc 38..262 CDD:238113 74/239 (31%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 73/238 (31%)
Tryp_SPc 42..263 CDD:238113 74/239 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436814
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.