DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and CG3505

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:385 Identity:89/385 - (23%)
Similarity:129/385 - (33%) Gaps:160/385 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLVFLALAVAAATAIPTPEQKLVPTPVKDV-KI-QGRITNGYPAYEGKVPYIVGLLFSGN----- 60
            |:|..:||:.|...:|         |:..| || .||:| |:.....:..|.:.:|.|||     
  Fly     8 LVVVGSLALGANAQLP---------PINCVAKIPSGRVT-GHCISIRECDYFMRILLSGNLSQSD 62

  Fly    61 ------------GN----------------------------W--------------W------- 64
                        ||                            |              |       
  Fly    63 RNLLRDNQCGVRGNDVQVCCPSTAGLGALTHPLLPSDCGKVRWQRSNDTDTRIREFPWLALIEYT 127

  Fly    65 ---------CGGSIIGNTWVLTAAHCTNGASGVTIN----------YGASLRNQPQYTHW----- 105
                     |||.:|.:.:|||||||.  |...|.|          :..|.....|| |.     
  Fly   128 RGNQEKIHACGGVLISDRYVLTAAHCV--AQAATSNLQITAVRLGEWDTSTNPDCQY-HEDSKVA 189

  Fly   106 --------VGSGNFVQHHHYNSGNLH--NDISLIRTPHV----DFWHLVNKVELPS-------YN 149
                    :.....:.|..||..:..  |||:|:|....    ||   |..:.||:       ..
  Fly   190 DCAPPYQDIAIEELLPHPLYNRTDRTQINDIALVRLASPAKLNDF---VQPICLPNKQLRADELE 251

  Fly   150 DRYQDYAGWWAVAS-----GWGGTYDGSPLPDWLQAVDVQIMSQSDCSRTWS-----LHDNMICI 204
            |...:.|||.|.:|     |:                 |.|.|..:|.|.::     :..:.:|.
  Fly   252 DLVTEVAGWQASSSQRMRKGY-----------------VTISSIEECQRKYASQQLRIQASKLCG 299

  Fly   205 NTNGGKSTCGGDSGGPLV--THEGNRLVGVTSFVSSAGCQSGAPAVFSRVTGYLDWIRDN 262
            .||  ...|.|::||||:  .::|..|.|:.||..........|.|::||..|:|||.|:
  Fly   300 LTN--SQECYGNAGGPLMLFKNDGYLLGGLVSFGPVPCPNPDWPDVYTRVASYIDWIHDS 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 75/344 (22%)
Tryp_SPc 38..262 CDD:238113 76/346 (22%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855 13/52 (25%)
Tryp_SPc 111..356 CDD:238113 66/269 (25%)
Tryp_SPc 111..354 CDD:214473 64/267 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435960
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.