DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and prss29

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001001228.1 Gene:prss29 / 407909 XenbaseID:XB-GENE-6453402 Length:330 Species:Xenopus tropicalis


Alignment Length:260 Identity:79/260 - (30%)
Similarity:116/260 - (44%) Gaps:56/260 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASLRNQPQ 101
            ||..|..:.||:.|:.:.|.|  .|.:.||||::.::||||||||.:.            .|..:
 Frog    25 RIVGGTDSEEGEWPWQISLEF--EGGFLCGGSLLTDSWVLTAAHCFDS------------MNVSK 75

  Fly   102 YTHWV--------------GSGNFVQHHHYNSGNLHNDISLIRTPH-VDFWHLVNKVELPSYNDR 151
            ||.::              |..|...|..|.......||:||.... :.|...:..|.|||    
 Frog    76 YTAYLGVYQLSDLDNAVLRGVKNITVHPDYMYEGSSGDIALIELEEPIVFTPSIQPVCLPS---- 136

  Fly   152 YQDY---AGWWAVASGWGGTYDGSPL--PDWLQAVDVQIMSQSDCSRTW--------SLH---DN 200
             ||.   .|.....:|||...:.:||  |..||..:|.:::::.|...:        |:|   |:
 Frog   137 -QDVPLPMGTMCWVTGWGNIKENTPLEDPQTLQKAEVGLINRTSCEAMYQSSLGYRPSIHLIQDD 200

  Fly   201 MICINTNGGK-STCGGDSGGPLVTHEGNRLV--GVTSFVSSAGC-QSGAPAVFSRVTGYLDWIRD 261
            |||.....|| ..|.||||||||.:..|..:  |:.|:  ..|| :...|.|::.|..||.||::
 Frog   201 MICAGYKQGKIDACQGDSGGPLVCNTSNTWLQFGIVSW--GLGCAEPNQPGVYTNVQYYLTWIQE 263

  Fly   262  261
             Frog   264  263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 77/256 (30%)
Tryp_SPc 38..262 CDD:238113 78/259 (30%)
prss29NP_001001228.1 Tryp_SPc 26..263 CDD:238113 78/257 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.