DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and MP1

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:294 Identity:78/294 - (26%)
Similarity:129/294 - (43%) Gaps:52/294 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PTPEQKLVPTPVKDVKI-----------QGRITNGYPAYEGKVPYIVGLLFSGNGN---WWCGGS 68
            |.|.|...||.....|:           ..|:..|....:.:.|::..:.::..||   ..||||
  Fly   107 PQPTQTTKPTKRSGTKLLPMAPNCGENFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGS 171

  Fly    69 IIGNTWVLTAAHCTNG------ASGVTI-NYGASLR-------------NQPQYTHWVGSGNFVQ 113
            :|.:.:|||||||.:.      .:||.: .:.||..             |:|...:.|...  :.
  Fly   172 LINHRYVLTAAHCVSAIPSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEER--IP 234

  Fly   114 HHHY--NSGNLHNDISLIR-TPHVDFWHLVNKVELPSYNDRYQD-YAGWWAVASGWGGTYDGSPL 174
            |..|  ||.:..|||:|:| ...|.:...:..|.||:...::.: :.|...|.:|||.|......
  Fly   235 HPQYPGNSRDQLNDIALLRLRDEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTS 299

  Fly   175 PDWLQAVDVQIMSQSDCSRTW-----SLHDNMICINTNGGKSTCGGDSGGPLVTHE---GNR--- 228
            ...|:| ::..:..|:|::.:     ::....:|.....|..:|.|||||||:..:   ||.   
  Fly   300 NIKLKA-ELDTVPTSECNQRYATQRRTVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYY 363

  Fly   229 LVGVTSFVSSAGCQSGAPAVFSRVTGYLDWIRDN 262
            :.||.|:..:.....|.|.|::||..||:||.:|
  Fly   364 IAGVVSYGPTPCGLKGWPGVYTRVEAYLNWIENN 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 69/259 (27%)
Tryp_SPc 38..262 CDD:238113 70/261 (27%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 69/259 (27%)
Tryp_SPc 138..397 CDD:238113 70/261 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435962
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.