DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and CG14088

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster


Alignment Length:240 Identity:53/240 - (22%)
Similarity:89/240 - (37%) Gaps:53/240 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 EGKVPYIVGLLFSGNGNWWCG-----------GSIIGNTWVLTAAHCTNGASGVTINYG--ASLR 97
            :|..|.|||.        |..           |::|...::||..||.:....:....|  ..:.
  Fly    36 DGLSPDIVGP--------WTAILHHFGRIVGVGTLIHERFILTDVHCGDSIGVIRARLGEYGRIG 92

  Fly    98 NQPQYTHWVGSGNFVQHHHYNSGNLHNDISLIRTPHVDFW--HLVNKVELPSYNDRYQDYAGWWA 160
            ::....|.|.:  |..:.::|.....|::.|::......:  |::....|  .:.|.|.:|....
  Fly    93 SELAEDHIVAA--FFSNANFNPETQANNMGLMKLLRTVVYKEHIIPVCIL--MDSRMQTFADELD 153

  Fly   161 VASG--WGGTYDGSPLPDWLQAVDVQIMSQSDCSRTWSLHDNMICINTNGGK--STCGGDSGGPL 221
            ..:|  |..: |.||:   |::..|..|.|: |.:   |.....|.   |.|  .:|...||..|
  Fly   154 YFNGTTWKNS-DKSPM---LRSKTVIRMPQA-CGK---LDHGQFCA---GHKDLDSCDEPSGAAL 207

  Fly   222 VTHE-----GNR--LVGVTSFVSSAGCQSGAPAVFSRVTGYLDWI 259
             |.|     .||  |.|:.:.| ...|.:.  ..::.|.....||
  Fly   208 -TREIDYIGPNRTVLFGIANSV-EVKCSNS--RTYTDVVQLHQWI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 51/238 (21%)
Tryp_SPc 38..262 CDD:238113 53/240 (22%)
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 51/234 (22%)
Tryp_SPc 42..248 CDD:214473 49/232 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.