DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and CG18179

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:274 Identity:126/274 - (45%)
Similarity:166/274 - (60%) Gaps:13/274 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLVFLALAVAAATAIPTP---EQKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGN 62
            |||.: |.|:||.|....:|   ...|:|........:|||.|||||.|||.|||||||...:|:
  Fly     1 MKLFL-LTLSVALAVVAASPGFNRTSLLPQVTISEGAEGRIVNGYPAPEGKAPYIVGLLIRTDGS 64

  Fly    63 WWC---GGSIIGNTWVLTAAHCTNGASGVTINYGASLRNQPQYTHWVGSGNFVQHHHYNSGNLHN 124
            ...   .|:||.:.|:||||||.. ...|.|:||::......:...|...||:.|.::.:.. ..
  Fly    65 NSAAVGAGTIIASDWILTAAHCLT-TDYVEIHYGSNWGWNGAFRQSVRRDNFISHPNWPAEG-GR 127

  Fly   125 DISLIRTPHVDFWHLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQS 189
            ||.|||||.|.|..|:|||.|||:::....:...|.||.||||..:|: |.||||.:||||:|.|
  Fly   128 DIGLIRTPSVGFTDLINKVALPSFSEESDRFVDTWCVACGWGGMDNGN-LADWLQCMDVQIISNS 191

  Fly   190 DCSRTW-SLHDNMICINTNGGKSTCGGDSGGPLVTHEGNRLVGVTSFVSSAGCQSGAPAVFSRVT 253
            :|.::: ::....:|.....|||:||||||||||||:..|||||.:| .|..|.|| |:.::|||
  Fly   192 ECEQSYGTVASTDMCTRRTDGKSSCGGDSGGPLVTHDNARLVGVITF-GSVDCHSG-PSGYTRVT 254

  Fly   254 GYLDWIRDNTGISY 267
            .||.||||||||||
  Fly   255 DYLGWIRDNTGISY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 104/225 (46%)
Tryp_SPc 38..262 CDD:238113 106/227 (47%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 104/225 (46%)
Tryp_SPc 40..263 CDD:238113 106/227 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470724
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.