DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and CG6462

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster


Alignment Length:255 Identity:86/255 - (33%)
Similarity:121/255 - (47%) Gaps:31/255 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IQGRITNGYPAYEGKVPYIVGLL--FSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASL 96
            ::.||..|..|..|..||.|||:  .||.....||||:|...:|||||||...|....|..||::
  Fly    73 VRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGATV 137

  Fly    97 -------RNQPQYTHWVGSGNFVQHHHYNSGNLHNDISLIRTPH-VDFWHLVNKVELPSYNDRYQ 153
                   ..:.|.||    .:|:.:..|.....::|::|||.|. |.....|..:||........
  Fly   138 FADVEDSVEELQVTH----RDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQN 198

  Fly   154 DYAGWWAVASGWGGTYDGS-PLPDWLQAVDVQIMSQSDC---------SRTWSLHDNMICINTNG 208
            ...|.....||||...|.: .....||.:|.:::.|..|         |:.     ..:|.:.:.
  Fly   199 FLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQR-----RHLCTDGSN 258

  Fly   209 GKSTCGGDSGGPLVTHEGN--RLVGVTSFVSSAGCQSGAPAVFSRVTGYLDWIRDNTGIS 266
            |:..|.||||||:|.|..|  .|:|||||.|:.||:.|.|.|::|:|.||.|||..|.::
  Fly   259 GRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYLPWIRQQTAMT 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 82/243 (34%)
Tryp_SPc 38..262 CDD:238113 84/245 (34%)
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 82/243 (34%)
Tryp_SPc 77..314 CDD:238113 84/245 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
65.820

Return to query results.
Submit another query.