DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and CG13527

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:264 Identity:75/264 - (28%)
Similarity:101/264 - (38%) Gaps:79/264 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VKIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGA-- 94
            |.|:.|..|.|                ...|.:|||.::.|.||:|||||..|.|  .|.|.|  
  Fly    45 VSIRSRTPNKY----------------FGDNHYCGGGLLSNQWVITAAHCVMGQS--KIMYKARW 91

  Fly    95 ---------SLRNQPQYTHWVGSG------------NFVQHHHYNSGNL-------HNDISLIRT 131
                     .||..|      |..            ||..|:.:|...:       .||      
  Fly    92 LLVVAGSPHRLRYTP------GKSVCSPVSSLYVPKNFTMHNTFNMALMKLQEKMPSND------ 144

  Fly   132 PHVDFWHLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDCSRTWS 196
            |.:.|.||..  |.|....|:        ...|||..|.|.||...:..|||.:|..:.| :|:.
  Fly   145 PRIGFLHLPK--EAPKIGIRH--------TVLGWGRMYFGGPLAVHIYQVDVVLMDNAVC-KTYF 198

  Fly   197 LH--DNMICINTNG---GKSTCGGDSGGPLVTHEGNRLVGVTSFVSSAGCQSGAPAVFSRVTGYL 256
            .|  |.|:|...|.   ....|.||.|.||::  |..:||:.::....|| :..|:|::.|...|
  Fly   199 RHYGDGMMCAGNNNWTIDAEPCSGDIGSPLLS--GKVVVGIVAYPIGCGC-TNIPSVYTDVFSGL 260

  Fly   257 DWIR 260
            .|||
  Fly   261 RWIR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 70/256 (27%)
Tryp_SPc 38..262 CDD:238113 72/258 (28%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 75/264 (28%)
Tryp_SPc 43..263 CDD:214473 72/261 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.