DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Fi and Ctrc

DIOPT Version :9

Sequence 1:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001071117.1 Gene:Ctrc / 362653 RGDID:1308379 Length:268 Species:Rattus norvegicus


Alignment Length:288 Identity:83/288 - (28%)
Similarity:122/288 - (42%) Gaps:57/288 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVFLALAVAAATAIPTPEQKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNW--WCG 66
            :..||..:|.|:....|   ..|.     .:..|:..|..|.....|:.|.|.:..:..|  .||
  Rat     4 ITVLAAILACASCCGNP---AFPP-----NLSTRVVGGEDAVPNSWPWQVSLQYLKDDTWRHTCG 60

  Fly    67 GSIIGNTWVLTAAHCTNGASGVTINYGASLRNQPQYTHWVGSGNF------------------VQ 113
            ||:|..:.|||||||.|                ..:|:.||.|.:                  ..
  Rat    61 GSLITTSHVLTAAHCIN----------------KDFTYRVGLGKYNLTVEDEEGSVYAEVDTIYV 109

  Fly   114 HHHYNSGNLHNDISLIRTPH-VDFWHLVNKVELPSYNDRY-QDYAGWWAVASGWGGTYDGSPLPD 176
            |..:|...|.|||::|:... |:..:.:....:|...... |||.   ...:|||..:...|:.:
  Rat   110 HEKWNRLFLWNDIAIIKLAEPVELSNTIQVACIPEEGSLLPQDYP---CYVTGWGRLWTNGPIAE 171

  Fly   177 WLQAVDVQIMSQSDCSRT--W--SLHDNMICINTNGGKSTCGGDSGGPL--VTHEGN-RLVGVTS 234
            .||.....|:|.:.|||.  |  .:...|:|...:|..|.|.|||||||  ...:|: ::.|:.|
  Rat   172 VLQQGLQPIVSHATCSRLDWWFIKVRKTMVCAGGDGVISACNGDSGGPLNCQAEDGSWQVHGIVS 236

  Fly   235 FVSSAGCQ-SGAPAVFSRVTGYLDWIRD 261
            |.||:||. ...|.||:||:.|.|||.:
  Rat   237 FGSSSGCNVHKKPVVFTRVSAYNDWINE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 75/251 (30%)
Tryp_SPc 38..262 CDD:238113 76/254 (30%)
CtrcNP_001071117.1 Tryp_SPc 29..262 CDD:214473 75/251 (30%)
Tryp_SPc 30..265 CDD:238113 76/254 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBU3
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.